Delphinapterus leucas (beluga whale): 111187634 Help Entry 111187634         CDS       T05885                                  Gene name CXCL8 Definition (RefSeq) interleukin-8 isoform X1   KO K10030   interleukin 8 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04061   Viral protein interaction with cytokine and cytokine receptor dle04062   Chemokine signaling pathway dle04064   NF-kappa B signaling pathway dle04072   Phospholipase D signaling pathway dle04218   Cellular senescence dle04620   Toll-like receptor signaling pathway dle04621   NOD-like receptor signaling pathway dle04622   RIG-I-like receptor signaling pathway dle04657   IL-17 signaling pathway dle04932   Non-alcoholic fatty liver disease dle04933   AGE-RAGE signaling pathway in diabetic complications dle05132   Salmonella infection dle05133   Pertussis dle05134   Legionellosis dle05135   Yersinia infection dle05142   Chagas disease dle05144   Malaria dle05146   Amoebiasis dle05161   Hepatitis B dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05171   Coronavirus disease - COVID-19 dle05200   Pathways in cancer dle05202   Transcriptional misregulation in cancer dle05219   Bladder cancer dle05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     111187634 (CXCL8)    04072 Phospholipase D signaling pathway     111187634 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111187634 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     111187634 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     111187634 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111187634 (CXCL8)    04621 NOD-like receptor signaling pathway     111187634 (CXCL8)    04622 RIG-I-like receptor signaling pathway     111187634 (CXCL8)    04657 IL-17 signaling pathway     111187634 (CXCL8)    04062 Chemokine signaling pathway     111187634 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111187634 (CXCL8)    05202 Transcriptional misregulation in cancer     111187634 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     111187634 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     111187634 (CXCL8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111187634 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     111187634 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     111187634 (CXCL8)    05135 Yersinia infection     111187634 (CXCL8)    05133 Pertussis     111187634 (CXCL8)    05134 Legionellosis     111187634 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     111187634 (CXCL8)    05171 Coronavirus disease - COVID-19     111187634 (CXCL8)    05164 Influenza A     111187634 (CXCL8)    05163 Human cytomegalovirus infection     111187634 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     111187634 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     111187634 (CXCL8)    05144 Malaria     111187634 (CXCL8)    05142 Chagas disease     111187634 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:dle04052]     111187634 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111187634 (CXCL8) Cytokines and growth factors [BR:dle04052]  Cytokines   Chemokines    111187634 (CXCL8) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Chemokines    111187634 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  111187634 NCBI-ProteinID:  XP_022455186 UniProt:  A0A2Y9QC61 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MITLELPRAKLAELCLLMKSILNCFFFFTAAVLSRMSSELRCQCINTHSTPFHPKFIREL RVIESGPHCENSEIIVKLVNGKEVCLNPKEKWVQKVVQIFLKRAEKKDP NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgatcacactggaattaccaagggcgaagctagctgagctatgcctgttaatgaaatca attcttaattgctttttttttttcacagctgcagttctatcaagaatgagctcagaactt cgatgccaatgcataaatacacactccacacctttccaccccaaatttatcagagaattg cgagtgattgagagtggaccacactgtgaaaattcagaaatcattgttaagcttgtcaat ggcaaagaggtctgcttaaaccccaaggaaaagtgggtgcagaaggttgtacagatattt ttgaagagagctgagaagaaagatccatga

DBGET integrated database retrieval system