KEGG   Delphinapterus leucas (beluga whale): 111187634
Entry
111187634         CDS       T05885                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8 isoform X1
  KO
K10030  interleukin 8
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04072  Phospholipase D signaling pathway
dle04218  Cellular senescence
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05132  Salmonella infection
dle05133  Pertussis
dle05134  Legionellosis
dle05135  Yersinia infection
dle05142  Chagas disease
dle05144  Malaria
dle05146  Amoebiasis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05219  Bladder cancer
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111187634 (CXCL8)
   04072 Phospholipase D signaling pathway
    111187634 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111187634 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111187634 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111187634 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111187634 (CXCL8)
   04621 NOD-like receptor signaling pathway
    111187634 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    111187634 (CXCL8)
   04657 IL-17 signaling pathway
    111187634 (CXCL8)
   04062 Chemokine signaling pathway
    111187634 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187634 (CXCL8)
   05202 Transcriptional misregulation in cancer
    111187634 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    111187634 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111187634 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111187634 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111187634 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111187634 (CXCL8)
   05135 Yersinia infection
    111187634 (CXCL8)
   05133 Pertussis
    111187634 (CXCL8)
   05134 Legionellosis
    111187634 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111187634 (CXCL8)
   05171 Coronavirus disease - COVID-19
    111187634 (CXCL8)
   05164 Influenza A
    111187634 (CXCL8)
   05163 Human cytomegalovirus infection
    111187634 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111187634 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111187634 (CXCL8)
   05144 Malaria
    111187634 (CXCL8)
   05142 Chagas disease
    111187634 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111187634 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111187634 (CXCL8)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Chemokines
   111187634 (CXCL8)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Chemokines
   111187634 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 111187634
NCBI-ProteinID: XP_022455186
UniProt: A0A2Y9QC61
LinkDB
Position
Unknown
AA seq 109 aa
MITLELPRAKLAELCLLMKSILNCFFFFTAAVLSRMSSELRCQCINTHSTPFHPKFIREL
RVIESGPHCENSEIIVKLVNGKEVCLNPKEKWVQKVVQIFLKRAEKKDP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgatcacactggaattaccaagggcgaagctagctgagctatgcctgttaatgaaatca
attcttaattgctttttttttttcacagctgcagttctatcaagaatgagctcagaactt
cgatgccaatgcataaatacacactccacacctttccaccccaaatttatcagagaattg
cgagtgattgagagtggaccacactgtgaaaattcagaaatcattgttaagcttgtcaat
ggcaaagaggtctgcttaaaccccaaggaaaagtgggtgcagaaggttgtacagatattt
ttgaagagagctgagaagaaagatccatga

DBGET integrated database retrieval system