KEGG   Delphinapterus leucas (beluga whale): 111187637
Entry
111187637         CDS       T05885                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin isoform X1
  KO
K09782  amphiregulin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111187637 (AREG)
   04012 ErbB signaling pathway
    111187637 (AREG)
   04390 Hippo signaling pathway
    111187637 (AREG)
   04151 PI3K-Akt signaling pathway
    111187637 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    111187637 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dle03110]
    111187637 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111187637 (AREG)
Chaperones and folding catalysts [BR:dle03110]
 Intramolecular chaperones
  Others
   111187637 (AREG)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111187637 (AREG)
SSDB
Motif
Pfam: EGF PI3K_1B_p101 Laminin_EGF
Other DBs
NCBI-GeneID: 111187637
NCBI-ProteinID: XP_022455189
UniProt: A0A2Y9Q7W5
LinkDB
Position
Unknown
AA seq 254 aa
MRAPLLPPAPVVLSLLIFGSAHYTAGLDVNDTYSGKGEPLSGDHTADGFEVTSRSQMSLG
SKISPESEMPSSSELSSGIDSDYAEEYDNEPQISGYIVDDLVKVEQVVKPKKDKTESEKT
SDKPKRKKKGGKSGKNRRNRKKKNPCDAEFQTFCIHGECKFIEHLETVSCQCHQDYFGER
CGEKSMKIHSMADSDLSKIALAAIAAFVSAMSFTAIAVIITLLVSDPSHCKVTNLSDALV
PLFSGSRDNRTFPF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctgccgccggcgcctgtggtgctgtcgctcttgatcttcggctca
gcccattatactgctggattagacgtcaatgacacctactctgggaaaggggaaccactt
tctggggaccacactgctgatggatttgaggtgacctcaagaagtcagatgtccttggga
agtaagatttctcctgagagtgaaatgccttctagtagcgaactgtcctcggggatcgac
tctgactatgccgaagagtacgataacgaaccacaaatatctggctacattgtagatgat
ttagtcaaagttgaacaggtagttaagcccaagaaagacaaaactgaaagtgaaaagact
tcagataaacccaaaagaaagaaaaagggaggcaaaagtggaaaaaatagaagaaataga
aagaagaaaaatccatgtgatgcagaattccaaactttctgcattcatggagaatgcaaa
tttatagagcacctggaaacagtatcatgccaatgtcatcaggattactttggtgaacga
tgtggggaaaagtccatgaagattcacagcatggctgacagcgatttatcaaaaattgct
ttagcagctatagctgcttttgtctccgccatgagcttcacagctattgctgttattatt
acactcctagtatcagatccgagtcactgcaaagtcacaaacctgagtgatgcattggtt
cctcttttcagtggatccagagataacagaacctttccattctga

DBGET integrated database retrieval system