KEGG   Delphinapterus leucas (beluga whale): 111187673
Entry
111187673         CDS       T05885                                 

Gene name
BTC
Definition
(RefSeq) probetacellulin
  KO
K09783  betacellulin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111187673 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111187673 (BTC)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111187673 (BTC)
SSDB
Motif
Pfam: EGF Shisa Sigma_reg_N Cadherin_C_2 Baculo_11_kDa Vpu EphA2_TM LapA_dom
Other DBs
NCBI-GeneID: 111187673
NCBI-ProteinID: XP_022455251
UniProt: A0A2Y9QJ26
LinkDB
Position
Unknown
AA seq 178 aa
MARAVPGSGASSLPLLLALALGLVILHCVVADGNSTRSPENDGLLCGDRGENCPATTTQP
KRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFYLRGDRGQIL
VICLIAVMVIFIILVVGICTCCHPLRKHRERIKKEEEMETLGKDITPINDDIQETSIA
NT seq 537 nt   +upstreamnt  +downstreamnt
atggcccgggccgtcccgggcagcggcgccagctccctgccactgctcctggccctcgcc
ctgggtctagtgatcctccactgtgttgtggcagatgggaattcaaccaggagtcctgaa
aatgatggccttctctgtggagatcgtggagaaaattgcccagctacgaccacacagcca
aagcgaagaggccacttctctcggtgccccaaacagtacaagcattactgcattaaaggg
agatgtcgcttcgtggtggccgagcagacgccctcctgcgtctgtgatgaaggctacgct
ggggcgagatgtgagagagttgacttgttttacctaagaggagatagagggcagattttg
gtgatttgtttgatagcagttatggtaatttttatcattttggtggttggcatctgcacg
tgctgtcatcctcttcggaaacatcgagaaagaataaagaaggaagaagaaatggaaact
ctaggtaaagatataactcctataaatgatgacattcaagagactagtattgcttaa

DBGET integrated database retrieval system