KEGG   Delphinapterus leucas (beluga whale): 111187714
Entry
111187714         CDS       T05885                                 

Gene name
TLR2
Definition
(RefSeq) toll-like receptor 2
  KO
K10159  toll-like receptor 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04145  Phagosome
dle04151  PI3K-Akt signaling pathway
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle05132  Salmonella infection
dle05134  Legionellosis
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111187714 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111187714 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111187714 (TLR2)
   04620 Toll-like receptor signaling pathway
    111187714 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111187714 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111187714 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111187714 (TLR2)
   05321 Inflammatory bowel disease
    111187714 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111187714 (TLR2)
   05134 Legionellosis
    111187714 (TLR2)
   05152 Tuberculosis
    111187714 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111187714 (TLR2)
   05161 Hepatitis B
    111187714 (TLR2)
   05171 Coronavirus disease - COVID-19
    111187714 (TLR2)
   05162 Measles
    111187714 (TLR2)
   05168 Herpes simplex virus 1 infection
    111187714 (TLR2)
   05169 Epstein-Barr virus infection
    111187714 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111187714 (TLR2)
   05144 Malaria
    111187714 (TLR2)
   05145 Toxoplasmosis
    111187714 (TLR2)
   05140 Leishmaniasis
    111187714 (TLR2)
   05142 Chagas disease
    111187714 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111187714 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111187714 (TLR2)
   04054 Pattern recognition receptors [BR:dle04054]
    111187714 (TLR2)
   04090 CD molecules [BR:dle04090]
    111187714 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111187714 (TLR2)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    111187714 (TLR2)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111187714 (TLR2)
Pattern recognition receptors [BR:dle04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   111187714 (TLR2)
CD molecules [BR:dle04090]
 Proteins
  111187714 (TLR2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Hyaluronan
  Cell surface receptors
   111187714 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_9 LRRCT
Other DBs
NCBI-GeneID: 111187714
NCBI-ProteinID: XP_022455358
UniProt: A0A2Y9QIX5
LinkDB
Position
Unknown
AA seq 785 aa
MPPALWTVWVLGSVISLPKEGASDQASSLSCDPTGVCDGRSRSLNSIPSGLTAAVKSLDL
SSNEITYVSNSDLRRCVNLRTLRLGANEIHTVEEDSFFSLRSLEYLDLSYNRLSYFSSSW
FRSLSALKFLNLLGNLYKTLGERSLFSHLPNLRILKVGNSNSFTEIQEKDFAGLTLLEKL
EINVPNLQTYAPKSLKSIQNISHLILHLKQPVLLLEIFVDILSSLEHLELRDTDLNTFHF
SEVSINETNTSIKKFTFRNVQITDESFPEVVKLFNYVSGGLEVEFDDCTHDGVGDFRTLT
LETIKHLGDVETLTIRKLHIPQFFLFHDLSNIYSLTGKVKRITIENSKVFLVPCLLSQHL
KSLEYLDLSENLMSEETLKNSACEHAWPLLKTLVLRQNRLKSLEKTGEILLTLKNLTNLD
ISKNNFHSMPETCQWPGKMKYLNLSSTRIQSLTRCIPQTLEILDISNNDLDSFSLILPKL
KELYISRNKLKTLPDASFLPVLLVMRISRNIINTFSKEQLDSFQKLKTLEAGGNSFICSC
DFLSFTQGQQSLAQVLIDWPEEYLCDSPSPVRGQRVRDTRLSPSECHRAAVVSAVCCALF
LSLLPVGFLCHRFHGLWYMKMMWAWLQAKRKPRKAPRRDICYDAFVSYSERDSYWVENLM
VQELEHFRPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDF
SHFRLFDENDDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPADETQQEGFWLNLR
AAIKS
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgccacctgctttgtggacagtgtgggtcttggggtctgtaatcagcctccccaaggaa
ggagcctctgatcaggcttcttctctgtcttgtgaccccactggtgtctgcgatggccgc
tccagatctttaaactccatcccctcagggctcacggcagctgtgaaaagccttgacctg
tccagcaatgagatcacctatgtcagcaacagcgacctgcggaggtgtgtgaacctcagg
actctgaggctgggggccaatgaaattcacacggtggaggaagattcttttttttcgctg
aggagtcttgaatatctggacttatcctataatcgtttatcttacttctcatcctcctgg
ttcagatccctttctgccttgaaattcttaaacttactgggaaatttatacaaaacactc
ggggaaagatctcttttttctcatctcccaaatctgcgaatcctgaaagtaggaaatagt
aacagcttcactgagattcaggaaaaggatttcgctgggctaactcttcttgagaaactt
gagattaatgttccaaatctgcagacatatgcgccaaagagtttaaagtcaatccagaac
atcagccatctgattcttcatctgaagcagcctgttttactgttggagatttttgtagat
attttaagttccttagaacatttagaactgagagatactgatttgaacacttttcatttt
tcagaagtatccatcaatgaaacgaatacatcgattaaaaagtttacatttagaaatgtg
caaatcactgacgaaagttttcctgaagttgtgaaactgtttaattatgtttctggaggc
ttagaagtagagtttgatgactgtacccatgatggagttggtgattttaggacattgact
ctggagacaattaaacacctaggtgacgtggagacattaacaatacggaagttgcatatt
ccacagtttttcttatttcatgatctgagtaatatatattcactcacaggaaaagttaaa
agaatcacaatagaaaacagtaaggtttttctggttccttgtttactttcacaacattta
aaatcattagaatatttggatctcagtgaaaacttaatgtctgaagaaaccttgaaaaac
tccgcctgtgagcatgcctggcccttactaaaaaccttagttttaaggcagaatcgtttg
aaatcattagaaaaaactggagaaattttgcttactctgaaaaacctgactaaccttgat
atcagtaagaataattttcattcaatgcctgaaacttgtcagtggccaggaaaaatgaaa
tacttgaacttatccagcacaagaatacaaagtttaacccgttgcattccccagacactg
gaaattttagatattagcaataacgatctcgattcattttctttgattttgccaaaactc
aaagaactttatatttccagaaataagttgaagactctaccagatgcctcctttttacct
gtattattagttatgagaatcagcagaaatataataaatactttctctaaggagcaactt
gattcttttcaaaaactgaagactttggaagctggtggcaacagcttcatttgctcctgt
gacttcctgtctttcacacaggggcagcagtccctggcccaggtcctgatcgactggcca
gaagaatacctgtgtgactctccatcccccgtgcggggccagcgggttcgggacacccgg
ctctcgccttctgaatgccacagggcagccgtggtgtctgccgtgtgctgtgcccttttc
ctgtcgctcctgcccgtgggatttctgtgccaccgtttccacggactgtggtacatgaag
atgatgtgggcctggctccaggccaagaggaagcccaggaaggccccccgcagggacatc
tgctatgacgcctttgtgtcctacagtgaacgggattcctactgggtggagaacctcatg
gtccaggagctggagcacttcagacctccctttaagttgtgtcttcacaaacgggacttc
attcctggcaagtggattatcgacaatatcattgactccattgaaaagagccacaaaacc
atctttgtgctttctgagaactttgtgaagagtgagtggtgcaagtacgagctggacttc
tcccattttcgtctctttgatgagaacgacgatgctgccattctcattctgctggagccc
attgagaaaaaggccatcccccagcgtttttgtaagctgcggaagatcatgaacaccaag
acctacttggagtggcccgctgatgagacgcagcaggaagggttttggttaaatttgaga
gctgcaataaagtcctag

DBGET integrated database retrieval system