KEGG   Delphinapterus leucas (beluga whale): 111187819
Entry
111187819         CDS       T05885                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04114  Oocyte meiosis
dle04115  p53 signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04730  Long-term depression
dle04750  Inflammatory mediator regulation of TRP channels
dle04913  Ovarian steroidogenesis
dle04914  Progesterone-mediated oocyte maturation
dle04935  Growth hormone synthesis, secretion and action
dle04960  Aldosterone-regulated sodium reabsorption
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05224  Breast cancer
dle05410  Hypertrophic cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111187819 (IGF1)
   04014 Ras signaling pathway
    111187819 (IGF1)
   04015 Rap1 signaling pathway
    111187819 (IGF1)
   04066 HIF-1 signaling pathway
    111187819 (IGF1)
   04068 FoxO signaling pathway
    111187819 (IGF1)
   04151 PI3K-Akt signaling pathway
    111187819 (IGF1)
   04152 AMPK signaling pathway
    111187819 (IGF1)
   04150 mTOR signaling pathway
    111187819 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111187819 (IGF1)
   04115 p53 signaling pathway
    111187819 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111187819 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    111187819 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    111187819 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    111187819 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    111187819 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111187819 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    111187819 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111187819 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    111187819 (IGF1)
   04213 Longevity regulating pathway - multiple species
    111187819 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187819 (IGF1)
   05202 Transcriptional misregulation in cancer
    111187819 (IGF1)
   05205 Proteoglycans in cancer
    111187819 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    111187819 (IGF1)
   05218 Melanoma
    111187819 (IGF1)
   05215 Prostate cancer
    111187819 (IGF1)
   05224 Breast cancer
    111187819 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111187819 (IGF1)
   05414 Dilated cardiomyopathy
    111187819 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111187819 (IGF1)
   01522 Endocrine resistance
    111187819 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111187819 (IGF1)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111187819 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 111187819
NCBI-ProteinID: XP_022455540
UniProt: A0A2Y9QDF3
LinkDB
Position
Unknown
AA seq 186 aa
MGKISSLPTQLFKCCFCDFLKVKMHITSSSHLFYVAVFLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYQPPSTNKKKKSQRRRKGGPKKHPGGEQKEGTEASQQADERKEGRA
EEGDWS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacatcacgtcctcctcgcatctcttctacgtggccgtgttcttgctt
accttcaccagctctgccacggctggacccgagaccctctgtggggctgagctggtggac
gcccttcagttcgtgtgcggagacaggggcttttatttcaacaagcccacggggtatggc
tcgagcagtcggagggcgcctcagacaggaatcgtggatgaatgctgcttccggagctgt
gatctgaggaggctggagatgtactgcgcgcctctcaagcctgccaagtcagcccgctct
gtccgtgcccagcgccacaccgacatgcccaaggctcagaagtatcagcccccatccacc
aacaagaaaaagaagtctcagaggagaaggaaaggtgggccaaagaaacatccaggaggg
gaacagaaggaggggacggaagcaagtcagcaagcagatgaaaggaaagaaggaagagca
gaggagggagactggagctag

DBGET integrated database retrieval system