KEGG   Delphinapterus leucas (beluga whale): 111187831
Entry
111187831         CDS       T05885                                 

Gene name
TIMP3
Definition
(RefSeq) metalloproteinase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111187831 (TIMP3)
   05205 Proteoglycans in cancer
    111187831 (TIMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111187831 (TIMP3)
Peptidases and inhibitors [BR:dle01002]
 Peptidase inhibitors
  Family I35: timp family
   111187831 (TIMP3)
SSDB
Motif
Pfam: TIMP
Other DBs
NCBI-GeneID: 111187831
NCBI-ProteinID: XP_022455586
UniProt: A0A2Y9QDB6
LinkDB
Position
Unknown
AA seq 211 aa
MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
NT seq 636 nt   +upstreamnt  +downstreamnt
atgactccctggctcgggctcgtcgtgctcctgggcagctggagtctgggggactggggc
gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactctgacatc
gtgatccgggccaaggtggtggggaagaagctggtgaaggaggggccctttggcacactg
gtctataccatcaagcagatgaagatgtaccgaggcttcaccaagatgccccacgtgcag
tacatccacacagaagcttccgaaagtctctgtggccttaagctagaggtcaacaagtac
cagtacctgctgacaggccgtgtctatgatggcaagatgtacacaggactgtgtaacttc
gtggagaggtgggaccagctcaccctttcccagcgcaaggggttgaactatcgatatcat
ctgggttgtaattgcaagatcaaatcctgctactacctgccttgctttgtgacctccaag
aacgagtgtctctggaccgacatgctctccaattttggctaccctggctaccagtccaaa
cactatgcctgcatccggcagaagggtggctactgcagctggtaccgaggatgggccccc
ccggacaaaagcatcatcaatgccacagacccctga

DBGET integrated database retrieval system