KEGG   Delphinapterus leucas (beluga whale): 111187883
Entry
111187883         CDS       T05885                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00860  Porphyrin and chlorophyll metabolism
dle01100  Metabolic pathways
dle04066  HIF-1 signaling pathway
dle04216  Ferroptosis
dle04978  Mineral absorption
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05225  Hepatocellular carcinoma
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    111187883 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111187883 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    111187883 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    111187883 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187883 (HMOX1)
   05206 MicroRNAs in cancer
    111187883 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111187883 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111187883 (HMOX1)
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     111187883 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 111187883
NCBI-ProteinID: XP_022455673
UniProt: A0A2Y9QJW1
LinkDB
Position
Unknown
AA seq 288 aa
MERPQPDSMPQDLSEALKEATKEVHTLAENAQFMKNFQKGEVTREGFKLIMASLYHIYVA
LEEEIEHNKENPVYTPLYFPEELHRRGALEQDMAFWYGSRWQEAIPYTQATRRYVQRLQE
VGRAEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNTLEMTPEVKKRVLAEAKAAFLLNIQLFEELQELLTQDAKDQSPSQAPGLRRRA
GSRAQDSAPTEASRGKPQLSILSQVPLMRWVLMFSFLVATVAVGLYTL
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcccgcagcccgacagtatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacaccctggcggagaacgcccagttcatgaagaactttcagaagggc
gaggtgacccgagaaggctttaagctgataatggcatctctgtaccacatctatgtggcc
ctggaggaggagatcgaacacaacaaggagaacccggtctacactcccctctacttcccg
gaagagctgcaccgaaggggcgccctcgagcaggacatggccttctggtatgggtcccgc
tggcaggaggccatcccctacacgcaggccaccaggcgctacgtgcagcgactccaagag
gtggggcgcgccgagcctgagctgctggtggcccacgcctacacccgctacctgggtgac
ctgtccgggggccaggtcctcaagaagatcgctcagaaggccctggacctgcccagctcc
ggagagggcctggccttcttcactttccccaacatcgccagtgccaccaagttcaagcag
ctgtaccgctcccgtatgaacactctggagatgacccccgaggtcaagaagagggtcctc
gctgaggccaaggcggccttccttctcaacatccagctgtttgaggagttgcaggaactg
ctgactcaggacgccaaggaccagagcccctcgcaggcaccaggccttcgcagacgggct
ggcagcagggcgcaagactctgctcccacggaggcgtccagggggaagccccagctcagc
atcctctcccaggtgccgctcatgcgatgggtcctcatgttcagctttctggtggcaacg
gttgccgtggggctttacaccttgtga

DBGET integrated database retrieval system