KEGG   Delphinapterus leucas (beluga whale): 111188083
Entry
111188083         CDS       T05885                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04068  FoxO signaling pathway
dle04144  Endocytosis
dle04218  Cellular senescence
dle04350  TGF-beta signaling pathway
dle04371  Apelin signaling pathway
dle04380  Osteoclast differentiation
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04659  Th17 cell differentiation
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05142  Chagas disease
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111188083 (TGFBR1)
   04350 TGF-beta signaling pathway
    111188083 (TGFBR1)
   04390 Hippo signaling pathway
    111188083 (TGFBR1)
   04371 Apelin signaling pathway
    111188083 (TGFBR1)
   04068 FoxO signaling pathway
    111188083 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111188083 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111188083 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    111188083 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111188083 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111188083 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111188083 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111188083 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111188083 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111188083 (TGFBR1)
   05212 Pancreatic cancer
    111188083 (TGFBR1)
   05225 Hepatocellular carcinoma
    111188083 (TGFBR1)
   05226 Gastric cancer
    111188083 (TGFBR1)
   05220 Chronic myeloid leukemia
    111188083 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111188083 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111188083 (TGFBR1)
   05161 Hepatitis B
    111188083 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111188083 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111188083 (TGFBR1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111188083 (TGFBR1)
Protein kinases [BR:dle01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   111188083 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 111188083
NCBI-ProteinID: XP_022455980
UniProt: A0A2Y9QES0
LinkDB
Position
Unknown
AA seq 503 aa
MEAAAAAPRPRLLLLVLAAVATLVPEVTALQCFCHLCTKDNFTCVTDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTVGPFPGKPSSG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccgcgtccccggctgctcctcctcgtgctggcggcggtg
gcaacgctggtcccggaggtgacggcattacagtgtttctgccacctttgtacaaaagac
aattttacttgtgtcacagatgggctctgctttgtctctgtcacagagaccacagacaaa
gttatacataatagcatgtgtatagctgaaatcgacctaattccacgagacaggccattt
gtatgtgcaccatcttcaaaaactgggtctgttactacaacatattgctgcaatcaggac
cactgcaataaaatagaactcccaactgttggcccttttccaggaaagccatcatctggc
cttggtcctgtcgaactggcagctgtcattgctggaccagtatgcttcgtctgcatctca
ctcatgttgatggtctatatctgccataaccgcactgtcattcaccatcgagtgccaaat
gaagaagatccttcattagatcgcccctttatttcagagggtactacgttaaaagattta
atttatgatatgacaacatcgggttctggatcaggtttaccattgcttgttcagaggaca
attgcgagaactattgtgttacaagaaagtattggcaaaggtcgttttggagaagtttgg
cgaggaaaatggagaggagaagaagtcgctgttaaaatattctcctctagagaagaacgt
tcatggttccgtgaggcagagatttatcagaccgtcatgttacgtcatgaaaacatcttg
ggatttatagcagcagacaataaagacaatggtacatggactcagctctggttggtgtca
gattatcatgagcatggatccctttttgattacttgaacagatacacagttactgtggaa
ggaatgataaaactcgctctgtccacagcaagtggacttgcccatcttcacatggagata
gttggtacccaaggaaaaccagccattgctcatagggatttgaaatcaaagaatatcttg
gtaaagaagaatggaacttgctgtattgcagacttgggactggcagtaagacatgattcg
gccacagatacaattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcc
cctgaagttctagatgattccataaatatgaaacactttgaatccttcaaacgtgctgac
atctatgcaatgggactagtattctgggaaatagctcgacgatgttccattggtggaatt
catgaagattaccagctgccttattatgatcttgtaccttctgatccatcagttgaagaa
atgagaaaagttgtttgtgaacagaagttaaggccaaatattccaaacagatggcagagc
tgtgaagccttgagagtgatggctaaaattatgagagaatgttggtatgccaatggagca
gctaggcttacagctctgcggattaagaaaacattatcacagctcagtcagcaggaaggc
atcaaaatgtaa

DBGET integrated database retrieval system