KEGG   Dietzia lutea: A6035_01005Help
Entry
A6035_01005       CDS       T05442                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dlu  Dietzia lutea
Pathway
dlu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A6035_01005
Enzymes [BR:dlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A6035_01005
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A6035_01005
    1.1.1.-  
     A6035_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AWH90993
UniProt: A0A2S1R402
LinkDB All DBs
Position
236630..237676
Genome map
AA seq 348 aa AA seqDB search
MTHDGTDRFVRMVAPRTAEIVAEGDLTPGDGQVVVDIGYCGICGTDTHGYDSAALSPAVF
GHEWMGVVAAVGPRVSQLEVGQRVVAGVGPACGDCAQCRAGHADHCDLAFAEANGVTDDA
PEHGGYGTRIRVSARRAIPVPDALSDVEAGLLEPATVTFHAVRRARISLGATVVVQGAGP
IGLLTAQHARAGGAGRIVVSEPSETRRLAARRLGFTDVVRPDELHSALAEASGGLGADVL
FECSGVASLLQPSAELVRRGGTLALLGYPGTDSSVNYGDWQSRELTVIGSLAYTHSDFLG
TMTLVAQGRIDVASLHTGTIGLDELESMFAELGSGQSTHTKVLVDPRR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgatggaacggaccgcttcgttcgaatggtggccccgcggaccgccgagatc
gtcgccgagggcgacctgacgcccggcgacggccaggtggtcgtcgacatcgggtactgc
ggcatctgcgggaccgacacgcacgggtacgactcagcagcgctctccccggcggtcttc
ggacacgagtggatgggcgtggtcgccgcggtcggtccacgggtgtcgcagctcgaagtc
ggacagcgcgtagtggccggtgtgggaccggcgtgcggcgactgcgcgcagtgtcgcgcc
ggtcatgccgaccactgtgatctcgcttttgccgaggcgaacggggtgaccgacgatgct
ccggagcacggcggatacgggactcgcatccgggtctcggcgcggcgcgccatcccggtt
cccgatgcgctgtcagacgtcgaggctggcctgttggaaccggcgaccgtgaccttccac
gcggttagacgagcgcggatctccctgggcgccaccgtcgtggtccagggcgcggggccg
atcggactgttgaccgcgcagcacgcgcgggccggtggggcggggcgcatagtggtctcc
gagccatcagagacacggcgcctggcagcgaggcgtctcggcttcaccgacgtcgtgcgc
ccagacgagttgcactctgcactcgccgaggcgtccggaggacttggcgccgacgtcctc
ttcgagtgctccggggtggcgtcgttactccagccgtcggccgaactggtgcggcggggc
ggcactctggcgctgctcggctacccgggaacggattcctcggtgaactacggcgactgg
cagagccgcgaactcaccgtgatcggctcactcgcctacacccactccgacttcctcggc
accatgaccctggtggcccagggccggatcgacgtcgcgtccctgcacaccggcaccatc
ggcctcgacgaattggagtccatgttcgccgaactcggctccggacagagcacgcacacc
aaggtgctcgtcgacccccgccgctag

DBGET integrated database retrieval system