KEGG   Dietzia lutea: A6035_03275Help
Entry
A6035_03275       CDS       T05442                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
dlu  Dietzia lutea
Pathway
dlu00250  Alanine, aspartate and glutamate metabolism
dlu00410  beta-Alanine metabolism
dlu00640  Propanoate metabolism
dlu00650  Butanoate metabolism
dlu01100  Metabolic pathways
dlu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A6035_03275
   00650 Butanoate metabolism
    A6035_03275
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A6035_03275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A6035_03275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dlu01007]
    A6035_03275
Enzymes [BR:dlu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A6035_03275
Amino acid related enzymes [BR:dlu01007]
 Aminotransferase (transaminase)
  Class III
   A6035_03275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AWH91352
UniProt: A0A2S1R524
LinkDB All DBs
Position
complement(751791..753080)
Genome map
AA seq 429 aa AA seqDB search
MTAHLSPLLKQATPVVVDHALGSWIHGTDGRDYLDFTTGIGVTSTGHCHPDVVAAAQEQC
GKIIHAQYTTVMHQPLLELTAKLGEHLPAGIDSVFYANSGSEAVEAAVRLARMATGRPNI
VTVQGGFHGRTVAAASLTTAGTRFSAGFSPLMGGVVMTPFPHALRHGWTTDDAVDFALAE
LDYLMATRVDAREIASFLIEPVLGDGGYMATPPRYLQGLRERADRIGALLVLDEVQAGIG
RTGRFWGHQHTDGLVPDVIITAKGIASGFPISAIAAPTELMAKAWPGSQGGTYGGNAVAA
AAGVATLGVVERENLVQRAADRGAQLLDGLRRSLADVSEICDIRGTGLMLGVEFGDPTAP
AGSAGALEAARLATAVQQACVDEELLTLTCGPTGSVVRLIPALVVTSEEVDAGVERFARA
VHRVCDGAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcacctgtcgccccttctcaagcaggccacgcccgtcgtggtggaccacgcc
ctcggctcgtggatccacggcaccgacggacgcgactacctggacttcaccaccggcatc
ggcgtgaccagcaccgggcactgccaccccgacgtcgtcgccgccgcgcaggagcagtgc
gggaagatcatccacgcgcagtacacgaccgtcatgcaccagccgctgctcgagctcacc
gccaagctcggcgagcacctgccggccggcatcgactcggtcttctacgccaactccggc
tccgaggccgtcgaggccgccgtgcgcctggcgcgcatggccacgggccgcccgaacatc
gtcacggtgcagggtgggttccacgggcgcacggtcgccgcggccagcctcaccacggcc
ggcacccgcttctccgccggcttctccccgctcatgggcggcgtggtgatgaccccgttc
ccccacgcgctgcgtcacggctggaccaccgacgacgccgtggacttcgcgctggccgag
ctcgactacctcatggccacgcgcgtcgacgcccgggagatcgcgtcgttcctcatcgag
cccgtcctcggcgacggcgggtacatggccactcccccgcgctacctgcagggattgcgc
gagcgcgccgaccggatcggcgccctgctcgtgctggacgaggtccaggccggcatcggg
cgcaccggccggttctggggccaccagcacaccgacggcctggtcccggacgtcatcatc
accgccaagggcatcgcctcgggcttccccatctccgcgatcgcggcgcccaccgagctc
atggccaaggcctggcccggctcccagggcggcacctacggcggcaacgccgtggcggcc
gcggccggggtcgcgacgctcggcgtggtcgagcgcgagaacctcgtgcagcgcgcggca
gaccgcggagcccagctcctcgacggcctgcggcgtagcctggcggacgtgagcgagatc
tgcgacatccgcgggaccgggctcatgctgggcgtcgagttcggcgatcccaccgcgccc
gccggcagcgccggcgcgcttgaggccgcgcgcctggcgacggccgtccagcaggcgtgc
gtggacgaggagctgctcaccctgacgtgcgggccgaccgggtcggtggtgcgcctcatc
cccgcgctggtggtcacctccgaggaggtcgacgccggcgtcgagcgcttcgcccgggcc
gtgcaccgggtgtgcgacggggcggcgtga

DBGET integrated database retrieval system