KEGG   Dietzia lutea: A6035_04595Help
Entry
A6035_04595       CDS       T05442                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dlu  Dietzia lutea
Pathway
dlu00020  Citrate cycle (TCA cycle)
dlu00480  Glutathione metabolism
dlu01100  Metabolic pathways
dlu01110  Biosynthesis of secondary metabolites
dlu01120  Microbial metabolism in diverse environments
dlu01130  Biosynthesis of antibiotics
dlu01200  Carbon metabolism
dlu01210  2-Oxocarboxylic acid metabolism
dlu01230  Biosynthesis of amino acids
Module
dlu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dlu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6035_04595
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6035_04595
Enzymes [BR:dlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A6035_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AWH91561
UniProt: A0A2S1R5N3
LinkDB All DBs
Position
1045746..1046969
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWKFIKDELIHPYLDVDLEYYDLGIESRDATDDQITVDA
ANAIKKHGVGVKCATITPDEARMEEFGLKRMYRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIVVGRHAFGDQYRATDFKAPGAGKVTITFTPADGSEPIEHEVVDLPEEGGVVM
GMYNFNKSIEDFARASFNYGLDRDYPVYLSTKNTILKAYDGAFKDIFQDVFDREFKDKFE
EAGLAYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHFRRHQQGEPTSTNPIASIFAWTRGLEHRGKLDNTPEVIEFAHQLE
DVVINTVEGGQMTKDLALLVGDDQEYLNTEDFLAALDENLKRTRAGS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagatcaaggtcgaggggacggtcgtcgaactcgacggcgacgagatgacgcgc
atcatctggaagttcatcaaagacgaactgatccatccctacctggacgtggacctcgag
tactacgacctcggaatcgagagtcgtgacgccaccgacgaccagatcaccgtcgacgcg
gcaaacgcgatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcacgcctgacgag
gcccgcatggaggagttcgggctcaagcgcatgtaccgctcgccgaacggcacgatccgc
aacatcctcggcgggaccatcttccgggccccgatcatcatctccaacgtcccccgtctc
gtgccgggctggaccaaaccgatcgtcgtcggccgtcacgccttcggtgaccagtaccgc
gccaccgacttcaaggccccgggggcgggcaaggtcaccatcaccttcacgccggccgac
gggtccgagccgatcgagcacgaggtggtggacctgcccgaggagggcggcgtggtgatg
ggtatgtacaacttcaacaagtccatcgaggacttcgcgcgcgcctcgttcaactacggt
ctcgaccgcgactatccggtgtacctgtccaccaagaacaccatcctcaaggcctacgac
ggcgccttcaaggacatcttccaggacgtcttcgaccgcgagttcaaggacaagttcgag
gaggcgggcctggcctacgagcaccggctcatcgacgacatggtggcgtcctcgctgaag
tgggagggcggatacgtgtgggcgtgtaagaactacgacggcgacgtgcagtccgacacc
gtggcacagggcttcggctcactcggcctgatgacctcggtcctgctcaccccggacggg
aagacctgcgaggccgaggccgcccacggcaccgtgacccgccacttccgccggcatcag
cagggcgagccgacctccaccaatccgatcgcctcgatcttcgcgtggacccgcggcctc
gagcaccgcggcaagctcgacaacacccccgaggtgatcgagttcgcccaccagctcgaa
gacgtcgtcatcaacacggtcgagggcggtcagatgaccaaggacctcgccctgctcgtc
ggcgacgaccaggaatacctcaacaccgaggacttcctcgccgcgctggacgagaacctc
aagcgcacccgcgccgggtcctga

DBGET integrated database retrieval system