KEGG   Dietzia lutea: A6035_05110Help
Entry
A6035_05110       CDS       T05442                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
dlu  Dietzia lutea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWH91640
UniProt: A0A2S1R5Q6
LinkDB All DBs
Position
1159705..1161174
Genome map
AA seq 489 aa AA seqDB search
MTTSLDRDALLIGTQWRSPATDDVIEVVSPHTEEVVARVPEGSVADMDAAVAAAREAFDH
GPWPRMSPGERIEVVARLSELYAARLDDMATVISTEMGSPISFSKLAQAPAPWMQIEAFL
KIAREFPWEETRPGALGGEVLVRHEPVGVVAAIPPWNVPQFTVLSKLIPALLTGCTIVIK
PAPETPLDTYLLADLLIEAGVPEGVVSIVAGGREVGEHLVRHRAIDKVAFTGSTAAGRRI
GAICGEQLKRCSLELGGKSAAIVLDDADVTTVVEGLKFVGVMNSGQACVAQTRVLVSRER
HDEVARAIADGIGSMTVGDPLDPATEIGPMVARRQQERVNSYIEIGQQEGATLLAGGPGR
PDGLDTGWYVRPTVFAGVDNSMRIAQEEIFGPVLSVIAYDDVDDAVRIANDSEYGLAGTV
WSADREAGLAIARRVRTGTYGVNTYTMDFAAPFGGFKASGVGREFGPEGLAQYTELKSVY
LEGPAVAGA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcactcgaccgcgatgccctgctgatcgggacgcagtggcgttcgccggcc
accgacgacgtcatcgaggtggtcagtccgcacaccgaggaggtcgtggcgcgcgtgccc
gagggttcggtggcggacatggacgccgccgtcgccgcggcgcgcgaggcgttcgaccac
ggtccctggccgcgcatgagccccggggagaggatcgaggtcgtcgcccgactgtccgag
ctgtacgccgcccgcctcgacgacatggcgaccgtcatctccaccgagatgggatcgccg
atctcgttcagcaagctcgcgcaggcgcccgccccgtggatgcagatcgaggcgttcctc
aagatcgcccgcgagttcccctgggaggagacccgccccggggccctcggcggcgaggtc
ctcgtgcgtcacgaaccggtcggcgtggtcgccgcgatcccgccgtggaacgtgccgcag
ttcacggtgctgtccaagctgatccccgccctgctcaccggctgcacgatcgtcatcaag
ccggcccccgagaccccgctggacacctacctgctggccgacctgctcatcgaggccggg
gtgccggagggggtcgtgagcatcgtcgccggcggccgcgaggtgggcgagcacctggtc
cggcaccgcgcgatcgacaaggtggctttcaccggatccaccgccgcgggccggaggatc
ggcgccatctgcggcgaacagctcaagcgctgctcgctcgagctgggtggcaagtccgcc
gcgatcgtcctcgacgacgccgacgtgacgaccgtggtcgagggcctgaagttcgtgggc
gtgatgaactccggacaggcgtgcgtggcgcagacccgcgtgctcgtgagccgcgagcgt
catgacgaggtggcccgggcgatcgccgacgggatcgggtcgatgactgtgggcgacccg
ctcgaccccgccaccgagatcggcccgatggtggcccggcgccagcaggagcgcgtgaac
tcctacatcgagatcggtcagcaggagggcgcgaccctgctcgccggcggccccgggcgt
ccggacgggctggacaccggctggtacgtgcggcccaccgtcttcgcgggcgtggacaac
tcgatgcgcatcgctcaggaagagatcttcggccccgtcctgtccgtcatcgcctacgac
gacgtcgacgacgccgtccgcatcgccaacgactccgagtacgggctggccggtaccgtg
tggtccgccgaccgggaggccggactggcgatcgcgcggcgagtccggaccggcacgtac
ggcgtgaacacctacacgatggacttcgcggcccccttcggcggattcaaggcctccggc
gtgggacgagagttcgggcccgagggactggcccagtacaccgagctcaagagcgtgtac
ctcgagggccccgccgtggccggggcctga

DBGET integrated database retrieval system