KEGG   Dietzia lutea: A6035_11480Help
Entry
A6035_11480       CDS       T05442                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dlu  Dietzia lutea
Brite
Translation factors [BR:dlu03012]
 Eukaryotic Type
  Elongation factors
   A6035_11480
 Prokaryotic Type
   A6035_11480
Mitochondrial biogenesis [BR:dlu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A6035_11480
Exosome [BR:dlu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A6035_11480
  Exosomal proteins of breast cancer cells
   A6035_11480
  Exosomal proteins of colorectal cancer cells
   A6035_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AWH92687
UniProt: A0A2S1R8R1
LinkDB All DBs
Position
complement(2537466..2538656)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADTYPDLNDAFAFDEIDKAPEEKA
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEILELVEMEVRELLASQEFDEDAPVVQISALKAL
EGDEKWVQAIVDLMQACDDSIPDPERETDKPFLMPVEDVFTITGRGTVVTGRIERGQINV
NEDVELIGIKDKATKTTITGIEMFRKLLDYGEAGDNVGLLVRGLKREEVERGQVVIKPGA
YTPHTNFEGQAYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNTE
MSVELIQPVAMDEGLRFAIREGGRTVGAGQVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcgaagttcgagcggacgaagccgcacgttaacatcggcaccatcggtcac
gtcgaccacggtaagaccaccaccaccgcggccatcaccaaggttctggcggacacctac
cccgatctcaacgacgccttcgcgttcgacgagatcgacaaggcgccggaggagaaggct
cgtggtatcacgatcaacatctcccacgtcgagtaccagactgagaagcgtcactacgcg
cacgtcgacgcccccggtcacgccgactacatcaagaacatgatcaccggtgcggcccag
atggacggcgccatcctggttgtggcggccaccgacggcccgatgccccagacccgtgag
cacgtcctgcttgcgcgtcaggtcggcgtgccgtacatcctcgtcgccctgaacaagtgc
gacatggtcgacgacgaggagatcctcgagctcgttgagatggaggtgcgggagctcctc
gcctcgcaggagttcgacgaggacgcccccgtcgtccagatctcggcgctcaaggcgctg
gagggtgacgagaagtgggttcaggccatcgtcgacctcatgcaggcgtgcgacgactcc
atccccgaccccgagcgtgagaccgacaagccgttcctcatgcccgtcgaggacgtcttc
acgatcaccggtcgtggcaccgtcgtcaccggtcgtatcgagcgtggccagatcaacgtg
aacgaggatgtcgagctcatcggcatcaaggacaaggccaccaagaccaccatcacgggc
atcgagatgttccgtaagctcctcgattacggcgaggccggtgacaacgtcggtctgctc
gtgcgcggtctcaagcgcgaggaggtggagcgtggtcaggtcgtcatcaagccgggcgcc
tacaccccgcacaccaacttcgagggccaggcgtacatcctgtccaaggacgagggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtaccacggacgtg
accggcgtcgtgaccctccccgagggcaccgagatggtcatgccgggcgacaacaccgag
atgagcgtcgagctcatccagccggtcgccatggacgagggcctgcggttcgccatccgt
gagggtggccgcaccgtcggcgccggccaggtcaccaagatcatcaagtga

DBGET integrated database retrieval system