KEGG   Dietzia lutea: A6035_13145Help
Entry
A6035_13145       CDS       T05442                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dlu  Dietzia lutea
Pathway
dlu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dlu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A6035_13145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dlu03400]
    A6035_13145
Enzymes [BR:dlu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A6035_13145
DNA repair and recombination proteins [BR:dlu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A6035_13145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AWH92962
UniProt: A0A2S1R9M4
LinkDB All DBs
Position
2902397..2905117
Genome map
AA seq 906 aa AA seqDB search
MATKGQKESVKVDGRTVRFTHPDKVLYEATGTTKADVLEYYTAVAPLLMTYAGNRPVTRK
RWPDGTDADSFFEKNLPQHAPDWVPSVTIEHSSRTVRYPVLDSPATLAWFAQQAALELHV
PQWTLTNGEPGRTRRIVIDLDPGEGVELDTTAKVALRVRDLLSEAGLESFPVTSGSKGIH
LYARLDKAVTAASASKVAKEIAQSLAKQTPDLVTATMKRSIRDGKVFVDWSQNSGAKTTV
APYSLRGRAEPWVAAPRSWEELGDGGLTHLHWDDVLKRLDSDGDLLDGLEGTAKKGGSAK
KKPATKAPAKKTPAEKKASSSGSASRAKKSSGGKKSSSSSDDEDPDRADTDADDTDGSTG
DTDSDGADTRAAEAEGCDASPTSEDAVVTSLAEYRRKRDRRRTPEPFEDEVETDRSEGDG
PIFVIQEHHARRLHYDLRLEHHGVLASWAVPKNLPTEPKDRRLAVNTEDHPLGYETFEGT
IPKGEYGAGHMTIWDRGTYECEKWREDEIIVWLDGDKVSGRYVLVRTSAEKNQWIVQYMK
DQSPDSFYGGRDNPKSRYPEGDKSASRSGGSGSGGSGRASRSDDSDRSDSAARPDTPPLP
MIPTAAEVTGLPDDTWAFEGKWDGYRVTVATNGEQTRLVSRNGNSMDWLADGFPGLAETL
EKPAVIDAELVILDSNGVPDFASLAKQAAAEGKDSSLPPVELFVFDVLEVDGVDLQSQPW
ERRREVLDLLAPALTEVERVHVPDVLDGPGDRALAEAEEYGWEGIVAKRRDSKYESGRRS
KAWLKQKLLTTTEAVVGGWRPGKGGRSGSLGSLLLGVPAETGLAYIGRVGTGFTDKQARA
LLDELEPLRRKTSPFVEQLPADARRDAIWVLPKIVVEVRHQGFTDDGNLRQPSWRDIRRD
KLPGDL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggcgactaaggggcagaaggagtcggtgaaggtcgacgggcggaccgtgcggttcacc
caccccgacaaggtgctctacgaggccaccggcaccaccaaggccgacgtgctggagtac
tacacggccgtcgcgccgctgctcatgacctacgccggcaaccggcccgtcacccgcaag
cgctggcccgacggcactgacgccgactccttcttcgagaagaacctgccccagcacgcg
cccgactgggtgccgagcgtgaccatcgagcactcctcgcgcaccgtccgttacccggtg
ctcgactcccccgcgaccctggcctggttcgcccagcaggccgccctcgagctgcacgtg
ccgcagtggactctcacgaacggtgagccggggaggacgcggcggatcgtcatcgacctc
gatccgggtgagggcgtggaactggatacgacggcgaaggtcgccctgcgcgtccgagat
ttgctgtccgaggcgggactcgagtcgttcccggtcaccagtggctccaaggggatccac
ctctacgcccggctggacaaggccgtcaccgccgccagcgcctccaaggtggccaaggag
atcgcgcagtccctcgccaagcagaccccggacctggtcaccgccaccatgaagcgctcc
atccgcgacggcaaggtgttcgtcgactggagccagaacagcggcgccaagaccaccgtc
gcgccgtactccctacgcgggcgggccgagccgtgggtggccgcgccccgctcgtgggag
gaactcggcgacggcggcctgacgcacctgcactgggacgacgtcctcaagcgactggac
tccgacggcgacctcctcgacggcctcgagggcacggccaagaagggcggctccgccaag
aagaagcccgccacgaaggcccccgccaagaagaccccggccgagaagaaggcgtcctcg
tccggctcggcgtcgcgggccaagaagtcgtccgggggcaagaagagctcgtcgtcgtcg
gatgacgaggaccccgaccgcgcggacaccgacgctgacgacaccgacggctccaccggc
gacaccgactcggacggcgcggacacccgcgccgccgaggccgagggctgcgacgcctcc
cccaccagcgaggacgcggtggtcacgagcctggcggagtaccggcgcaagcgggatcgc
cgtcgcacgcccgagccgttcgaggacgaggtcgagaccgatcgctcagagggcgacggg
cccatcttcgtgatccaggaacaccacgcgcgccgcctgcactacgatctgcggctcgaa
caccacggggtcctggcctcgtgggccgtgcccaagaacctgcccaccgagcccaaggac
cgccggctcgcggtgaacaccgaggaccacccgctcggttacgagacgttcgagggcacc
atccccaagggcgagtacggcgccggccacatgaccatctgggaccgcggcacctacgag
tgcgagaagtggcgcgaggacgagatcatcgtgtggctcgacggcgacaaggtctccggc
cggtacgtcctcgtccgcacgagcgccgagaagaaccagtggatcgtgcagtacatgaag
gaccagtcgcccgactccttctacggcggccgcgacaacccgaagtcgcggtatcccgaa
ggcgacaagtccgcgtcgcgctccggcggcagcggctccggaggttccggccgcgcgtcc
cgctccgacgactccgaccgatccgacagcgccgcccgccccgacacgcccccgctcccc
atgatccccacggccgccgaggtcaccgggctgcccgacgacacgtgggcgttcgagggc
aagtgggacggttaccgcgtgaccgtggcgaccaacggcgagcagacccgcctggtcagc
cgcaacggcaactccatggactggctcgccgacggcttccccggactggccgagacactc
gagaagcccgccgtgatcgacgcggagctcgtcatcctcgactccaacggcgtgcccgac
ttcgcctcgctggccaagcaggccgccgccgagggcaaggactcgtctcttccgccggtc
gagctgttcgtctttgacgtgctcgaggtcgacggcgtggatctgcagtcgcagccgtgg
gagcgtcgccgcgaggtgctggacctgctcgccccggcgttgaccgaggtcgagcgtgtg
cacgtgcccgacgtcctcgacgggcccggcgaccgcgccctggccgaggccgaggagtac
ggctgggagggcatcgtcgccaagcgtcgcgactcgaagtacgagtcaggccggcggtcg
aaggcgtggctcaagcagaagctgctcaccaccaccgaggcggtcgtcggcggctggcgg
cccggcaagggcggacgctccggctcgctgggctccctgctgctgggcgtgcccgccgag
acggggctggcctacatcgggcgcgtcggcaccgggttcaccgacaagcaggcgcgcgcc
ctgctcgacgagctcgagcccctgcgccggaagaccagccccttcgtggagcagctgccc
gctgacgcccgccgcgatgccatctgggtcctacccaagatcgtcgtggaggtccgccac
cagggcttcaccgacgacggcaacttgcgccaaccctcctggcgcgacatccgccgcgac
aagctgccaggggacttgtag

DBGET integrated database retrieval system