KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0888Help
Entry
Dehly_0888        CDS       T01264                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00500  Starch and sucrose metabolism
dly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dehly_0888
Enzymes [BR:dly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Dehly_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ADJ26190
UniProt: D8K0R2
LinkDB All DBs
Position
870827..873238
Genome map
AA seq 803 aa AA seqDB search
MTLIRHDRTAFGRPGSAPNWTGGAKDGVGTARNSVSRVWFTLSRGMVTELFYPTIDQPQV
RHLELLVSDGESFVQSESRHLFTETRTITPHSLSYRVINSDPEGRYVINKTVIADPSSPC
ILQKVETSGASEWLSRLKLFVQCAPHLAGGGWNNNAMVVESAGRTLLAAEKDGTWLVLGA
NVPFIKVSCGYSGVSDGWRDLAEDHRLDWEFNSATDGNVVLTAELPVDKPGGFTLGLAFG
DSLQHAITNLFHSLALPFEERLSLYDTQWSSYYRTLRSLEKYSTDGGTLAQASVALLSSH
EDKTYPGAFIASMSIPWGESRAAGDGGAGYHLVWTRDMVNTVTGLLAAGDSEPARRALVY
LSAAQGSEGNFPQNFWLDGRPHWQGVQLDEVAFPVLLAWKMHRARTPVGIDTYPLITRAA
AFLIDYGPATEQERWEENSGYSPSTLASNIAALICAASFCREYGDATTGAFIEDYADFLE
AHLEQWTVTDRGRLTKGITRHYIRINPVAVDGIHHDDTPGDKTIYLQNQEPGNSAEFPAR
DIVDAGFLELVRYGIRAADDPLIRDSLKVIDAVLKVDTPFGQVWRRYNHDGYGQRTDGGD
YQGWGRGGGWPLLTGERAHYELAAGGDINQYLTAMEGFSSYTGLLPEQVWDRDDLPEAGM
YQGRPTDAAMPLMWAHAEYIKLLRSRADGQVFDRIPEVADRYLKKNRQRTEHEVWKPNYR
PSYIRAGTRLRVITPGSFQLVWTMDDWSTVNKTQATATGIGLYYVDLATAPKQRQPVIFT
FFWTGEDRWEGRNYEVKVKGAEE
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgacactgatcagacatgaccggacggctttcggacgccccggttcggcaccgaactgg
acgggcggcgccaaggatggcgtcggtaccgcccgtaactcggtcagccgggtctggttt
accctgtcccggggaatggtcaccgagctgttctacccaaccatcgaccagccacaggtc
agacacctggaactcctggtaagcgatggcgagagttttgtccagtcggaaagccgccat
ctgtttaccgaaacccggacgataacgccccacagcctgagttaccgtgtcatcaactcc
gaccccgaagggcgttatgtcatcaataaaaccgtcatcgccgacccgtcgtcgccatgt
atcctgcagaaggtcgaaaccagcggcgccagtgaatggctttcccgtcttaagttgttc
gtccaatgcgcaccccatcttgccgggggcggctggaacaataacgccatggtggtggaa
tctgccggcagaacactgctggcggccgaaaaagacggtacatggctggtgctgggggcg
aatgtgcccttcataaaggtgtcctgcggttacagcggcgtcagcgacggctggagagac
ctggccgaagaccaccggctggactgggagttcaatagcgctaccgacggtaacgtcgtc
ctgacagcggaactgccggtcgacaaacctggcggcttcaccctcggactggctttcggc
gacagccttcagcacgccatcaccaatctgttccattctctggcattaccgttcgaggaa
cgcctttcactgtacgacacccagtggtcaagctattaccggacactaaggtcactggaa
aaatactctactgacggcggcacgctggcccaggcgagtgtcgccctgctgtcatcccat
gaggataaaacttaccctggagccttcatcgcttcgatgtcaataccctggggcgaaagc
cgcgcggccggcgacgggggcgccggttatcacctggtgtggacccgtgacatggttaat
accgtcaccggcctgctggccgccggcgattcagaaccggctcgccgggcactggtctat
ctgtcggcggcccagggcagtgagggcaatttcccgcagaacttctggctggacggccgg
cctcactggcagggcgttcaactggacgaagtagccttcccggtactgctggcctggaaa
atgcaccgcgccaggactccggtaggcatcgatacctacccgctgataacccgggcggcc
gcgttcctgattgattacggcccggccaccgaacaggaacgctgggaggagaattccggg
tattccccctcgacactggcgtccaacatcgccgcgctcatctgcgccgcgtctttctgc
cgggaatatggcgatgcgactacgggagctttcatcgaggattacgccgatttcctcgaa
gcccacctggaacagtggacggtgaccgaccggggtcgtctgaccaagggcatcacccgt
cattacatccgcatcaatccggtggcggtcgatggtattcaccatgacgatacccccggt
gacaagacgatttacctgcagaaccaggaaccgggaaactcagccgagtttccggcccgc
gatatcgtcgatgccggcttcctggaactggtacgttacggcatccgtgcggctgacgat
ccgcttatccgggactccctgaaagtcatcgacgcggtactcaaggtcgataccccattc
ggtcaggtatggcgccgctacaatcatgacggctacggccagcgaacggacggcggcgat
tatcagggctggggacgcggcggcggctggccgctgttgaccggcgaacgggcgcattac
gaactggccgccggaggcgacatcaaccaatacctgaccgccatggaggggttttcatcc
tacaccggcctgttgccggaacaggtctgggaccgggacgatttaccggaggcgggcatg
taccaggggcgtccgaccgacgccgccatgccgttaatgtgggcgcatgccgaatatata
aagctgttgcgctcacgagctgacggccaggtctttgaccggatacctgaagtagccgac
cggtatctgaagaagaaccgacagagaaccgaacatgaagtctggaagcccaattatcgg
ccgtcttatatccgggccggaacccggttgagagtgattactccgggatctttccaactg
gtgtggacgatggatgactggtctaccgtcaataagacccaagctacagccaccggcatc
ggtctgtattatgtcgacctggccaccgccccaaaacagcgacagccggtgatattcact
tttttctggaccggtgaagaccgttgggaaggccgaaattatgaagtcaaggtaaaagga
gccgaagaatga

DBGET integrated database retrieval system