KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1386Help
Entry
Dehly_1386        CDS       T01264                                 

Definition
(GenBank) ABC transporter related protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
dly  Dehalogenimonas lykanthroporepellens
Brite
KEGG Orthology (KO) [BR:dly00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dly02000]
    Dehly_1386
Transporters [BR:dly02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Dehly_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 SMC_N MukB AAA_29 AAA_15 AAA_23 AAA_16 AAA_22 TrwB_AAD_bind AAA_30 AAA_27 SbcCD_C RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADJ26674
UniProt: D8K246
LinkDB All DBs
Position
complement(1365468..1366361)
Genome map
AA seq 297 aa AA seqDB search
MPTVKLTGINKTYGAVRVVNDVSFEVDGGEIFALIGPNGAGKSTTIRMMMDIIKPDSGDI
VIMNEHLGEAGKNRIGYLPEERGLYRKLKIMDTVAYLASLKGAEPADAIARAEAMLKTFG
LFEHRYKKIEELSKGMGQLTQFVVTVAHNPDLIILDEPFAGLDPVNSRLLKDTVRGLRAE
GKAVILSTHRMNEVEEMCDRLFMINKGREVLYGRLDDIRRRFRAHAAVVESLEPVPDNIP
GVIGRQVNGRVTELQLDAGTSPQQLLSSLVAAGHPVERFEVATPSLDEIFVRVVNQP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcccacggtcaagctgaccggaatcaacaagacttatggcgccgtccgggtagtgaat
gatgtgtcctttgaagtggacggcggcgaaatcttcgccctcatcggtcccaacggcgcc
ggtaagtccaccaccatccgcatgatgatggacatcatcaagccggactccggcgacatt
gtcatcatgaacgaacacctgggcgaggccggcaagaaccgcatcggctacctgccggaa
gagcgcggactctaccgcaagctcaaaatcatggacaccgtcgcctacctggcgtcactc
aagggggcggaacccgctgacgcgatagcccgcgccgaggccatgctcaagacgttcggg
ctgttcgagcatcgctacaagaaaatcgaggagctgtccaagggtatgggccagctgacc
cagttcgtggtcaccgtggcccacaatcccgacctcatcatcctggatgagcccttcgcc
gggctggacccggtcaattcaagactgctcaaggataccgtccgcggactccgggccgaa
ggcaaagccgtcatcctgtccacccaccgcatgaacgaggtggaagagatgtgcgaccgg
ctgttcatgatcaacaagggccgggaagttctttacggccggctggacgacatccgccgc
cgtttccgcgcccatgccgccgtggtggaatcactcgagccggtgcctgacaatattccc
ggcgtcatcggccgacaggtgaacggccgtgtcaccgagctccagctcgatgccggcacc
tcgccccagcaactgctcagttccctggtggccgccggacatcccgtggaacgcttcgag
gtggcgacgcccagcctggatgaaatcttcgtccgggtggtgaaccagccatga

DBGET integrated database retrieval system