KEGG   Desulfovibrio magneticus: DMR_08110Help
Entry
DMR_08110         CDS       T00917                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01130  Biosynthesis of antibiotics
dma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DMR_08110 (aroK)
Enzymes [BR:dma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     DMR_08110 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_16 Cytidylate_kin AAA_18 ABC_tran dNK NB-ARC AAA_22 TsaE AAA_28 Cytidylate_kin2 NACHT AAA AAA_5 AAA_30 SRP54 CoaE AAA_17 IPT DUF87
Motif
Other DBs
NCBI-ProteinID: BAH74302
NITE: DMR_08110
UniProt: C4XJU7
LinkDB All DBs
Position
908517..909047
Genome map
AA seq 176 aa AA seqDB search
MEPTLLGRVSDERCVSLIGMAGAGKTTLAGLLARRLGWACLDTDRLIEAQCRAPLPDILA
GQGLAGFLALEEDVVAGLGVKRCVVATGGSVVYGARAMARLKSMGPVVYLSIDLPTFLAR
VGDPGERAFVMPAGLTMADVYAERQPLYAAAADLTVASCGTTPEACVETILQGIRS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgacgcttctaggccgggtatccgatgaacggtgcgtgagtctcataggcatg
gccggagccggcaagaccaccctggccgggcttctggcccgacgcctgggctgggcctgt
ctggacaccgaccgtctcatcgaggcccagtgccgcgcccccttgcccgacatcctggcc
ggtcagggactggccggctttctggcccttgaagaagacgtggtggccgggcttggcgtc
aagcgttgcgtggtggccacgggcggttccgtggtctacggagcccgggccatggcccgc
ctcaaatccatggggccggtggtctacctgtccattgatctgcccaccttcctggcccgg
gtgggcgatcccggggaacgcgcctttgtcatgcccgccggcctgaccatggccgacgtc
tacgccgagcgccaacccctgtacgccgccgccgccgacctcaccgtcgccagctgcggc
acgacgcccgaggcctgcgtcgaaaccatcctgcaaggaatccggtcgtga

DBGET integrated database retrieval system