KEGG   Desulfovibrio magneticus: DMR_29360Help
Entry
DMR_29360         CDS       T00917                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase family protein
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00030  Pentose phosphate pathway
dma01100  Metabolic pathways
dma01120  Microbial metabolism in diverse environments
dma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DMR_29360
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DMR_29360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: BAH76427
NITE: DMR_29360
UniProt: C4XHQ3
LinkDB All DBs
Position
complement(3315218..3317206)
Genome map
AA seq 662 aa AA seqDB search
MVCGWNRCILRVDLSEKTVQSIPLSEELLEKYLGGMGLADKIIWDYILEKDIRAGFDPLS
PDNIFVIAMGPLTGLSTQGGRGIYQYISPVTGHLGGGSGGGFVHAMLKQAGYDALVITGK
ADQPVYLWIDDDSVSIKDASELWGLGAHQTVSTLKKQHGEVCSVVIGPAGENLVRHATAM
IDGFKSAGGKCGTGAVLGSKNLKAIVVRGKKGVNVADPKAFLENDADFRNAIKENSAWPR
FALWLAYFHTTPFKPRLAEHIYDYAVRLEACWNCHMACCGYHEQSRGKYPTRGTGPEIAN
QESFSALGVNDLEALNYYSDLLNDYGIDWKEGPGDIGIVMQLYKDGVLSAKDTDGLELDS
GDGKIIEEMIHWMAKRERIGNLVAEGKMNIARLFPEARKYDNTVRGTTGYGKDDPRTDRR
NIGPAVMCHFTPYRGACLETWGWQSIGLADFSWEFPGKEGLRSGRGYTREEAAEIVKEVV
GADDHAMFSKGEPKGWCKLNVRIGNWVVANESLILCRRIACIVDNNITRAGISARMLSTA
TGKEFTTESIERIGERIFNLQRMIDARLGITRTQDKFPEYFYQPLGDGMGGLTEEDEKVI
HEEMDYYYSLRGWDLETGQPTKEKAEELGLAIEWTALQKDGPYKDWEGPPLAGVSRGQRA
AS
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
ttggtctgtggttggaaccgttgtattctgagagtcgatttgtcggaaaaaacggtacaa
agtataccgttgtccgaggaattgcttgagaaatatcttggaggaatggggctcgccgac
aagattatctgggattatatccttgaaaaggatatacgggcggggttcgacccgttgagt
ccggacaatatcttcgtcatcgccatgggcccgttgaccgggctctccacccagggcgga
agagggatatatcaatacatcagcccggtgaccggacatcttggcggcggttcgggcggc
ggcttcgtccatgcgatgctcaagcaggcggggtatgacgctttggtcattacggggaaa
gccgatcagcctgtgtatctctggatcgacgacgattccgtgagcattaaggatgcatcg
gaactgtggggtctgggcgcgcaccaaacggtgtcgacgctgaaaaagcagcatggtgaa
gtctgcagcgttgtcatagggccagccggtgaaaacctggtacgccatgcgaccgccatg
atcgatggattcaagtctgctggcggaaaatgtggtacaggagccgtgcttgggtcgaaa
aatctgaaagcgatcgttgtcagaggcaaaaagggcgtcaatgttgccgacccgaaagcg
tttctggagaacgatgcagattttcgcaatgccattaaagaaaacagcgcttggccgcgc
tttgcactctggctcgcctattttcatacgacacctttcaagccaaggctggccgaacac
atttatgattacgctgtcaggctcgaagcatgctggaactgtcatatggcttgttgtgga
tatcatgaacagagcaggggaaaatatccgacacgcggaacggggccggagatcgcaaac
caggagagcttttccgctctgggcgtcaacgaccttgaagcgctgaattattattccgat
ttgctcaacgactatggaatagattggaaagaaggacctggtgatattggcatcgtcatg
caattatacaaagatggcgtcctttccgcaaaagacaccgacggactcgaacttgattcc
ggagatggcaagatcatcgaggagatgatccactggatggcgaagcgggagcgtattggc
aaccttgttgccgaagggaaaatgaacattgccaggctgtttcccgaagctcgaaagtac
gacaacacggtgcgggggacgaccggatacggtaaggacgatccgcggacggacaggagg
aatatcggcccggctgtcatgtgccattttacgccctataggggtgcttgcttggagacc
tgggggtggcagtcaattggtctggccgatttcagctgggaattcccgggaaaagaagga
cttcgttctggcagagggtatacaagggaggaggcggccgaaatagtcaaggaggttgtc
ggagctgacgaccatgcaatgttcagcaagggtgagcccaaagggtggtgcaagctaaac
gtcaggataggcaattgggttgtcgccaacgaaagcctcatcttgtgcagacggatagcc
tgcatcgttgacaacaatattacgcgggccggcatttccgcgcgcatgttgtccacggcg
actggaaaagaatttacaacggagtcgatcgaaagaattggggaaagaatcttcaatttg
caaagaatgatcgatgccaggctggggataacgcgaacgcaggacaagtttccagaatat
ttctaccagccgctcggcgatggcatgggaggcctgactgaagaagatgaaaaggtcatt
catgaggaaatggactactattattccttgagaggctgggacctggaaactgggcagccg
acaaaggagaaggccgaagaattgggcttggctatcgagtggactgccttgcaaaaggac
ggcccctacaaggactgggaggggcccccattggcaggtgtgtctcgtgggcaacgtgct
gcctcgtag

DBGET integrated database retrieval system