Solidesulfovibrio magneticus: DMR_39970 Help Entry DMR_39970         CDS       T00917                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dma  Solidesulfovibrio magneticus Pathway dma01100   Metabolic pathways dma01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dma00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DMR_39970 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DMR_39970 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  BAH77488 NITE:  DMR_39970 UniProt:  C4XNY7 LinkDB All DBs Position 4519899..4520135 Genome browser AA seq 78 aa AA seqDB search MSVAEKVKEIIVDQLGVDAAEVNPDAKFVDDLGADSLDLTELIMAMEEEFGVEISDEDAQ QIQKVQDAISFIEKKKGE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgtcgctgaaaaagtcaaagagatcatcgtggatcagctcggcgtcgatgccgct gaagtcaacccggacgccaagttcgtggacgacctgggcgccgactccctggatctgacc gagctcatcatggccatggaagaggagttcggcgtcgaaatctccgacgaggacgcccag cagatccagaaagtccaggacgccatctcctttatcgaaaagaaaaagggcgagtaa

DBGET integrated database retrieval system