KEGG   Desulfovibrio magneticus: DMR_45660Help
Entry
DMR_45660         CDS       T00917                                 

Definition
(GenBank) putative glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00500  Starch and sucrose metabolism
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DMR_45660
Enzymes [BR:dma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     DMR_45660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: BAH78057
NITE: DMR_45660
UniProt: C4XRZ1
LinkDB All DBs
Position
5174234..5176804
Genome map
AA seq 856 aa AA seqDB search
MQPLRVYSVVPKLPEKLRPLWDLAYNLLFSWNDDIVSLFAQVDRKIWRECYGNPVCFLNR
LPQKTLEALAEDDFFVERVADLRQSLATYLARKNSSIPFPDRDGTPVIAYFSLEYGISQC
LPVYSGGLGILAGDHLKSASDLCVPLVGIGLCYQQGYFRQYLTPDGWQQERYPIYDFEQM
PLTLCKDEAGNPLLVHVDLKGERVAAQLWKAQVGRVSLYLMDTNVPENQPGTRQLTNRLY
GGDLETRVRQEYLLGIGGIRALEVLGLKPKVIHMNEGHSAFAGLERIANFMDKHQLSFEA
AMELVASSSIFTTHTPVPAGNDRFPPELIQAYFEDYAKRLGLAFKVLLALGREDPRNDTE
HFCMTVLALKLSRFNNGVSQLHGEVSRKMWNRVWTQYPMEDVPIGAITNGVHVPTWVAQD
LAALYDRYLGANWREDPDTTRVFSQAHLISDAELWRTHERLRERLIGYVRERLRDQLLAR
GAKRKELQTAEEVLDPQALTIGFARRFATYKRAGMLLQDKERLIRIMSDAKRPVQFIFAD
KAHPHDNEGKRLIQELVQLCTSPTCRYNMVFLEDYDMEIASYLVQGVDVWLNTPRRPLEA
CGTSGMKAMCNGVLNFSTLDGWWAEAWKPDNSVGWAVGMGEEYEDAGYQDFVESQTLYNI
LENEIIPTFYERGHGNLPRNWIRKMKDSICELTPVYNSHRMVEDYARIAYIPALENYTRL
TREECAPAKDLASWRMDIMTKWGGLDVRNVRAGDPEQLHVGDPVRVTCEVHLNGIRPQDV
SVQIYAGRLDVEGKFAQRETVDMRPVETTADGWHVYMGEVQPSEAGRFGFTVRVLPHHPL
LLDSHSLGLIRWAQGA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgttacgtgtctacagcgtggtgccgaaacttccggagaagctgcggccgctt
tgggatctggcctataatctgctcttttcctggaacgacgacatcgtgtcgcttttcgcc
caggtcgatcgtaaaatctggcgcgagtgctacggcaatccggtctgcttcctcaaccgc
ctgccgcaaaagaccctggaagccctggccgaggacgactttttcgtggagcgcgtggcc
gatctgcgccaaagcctggccacctatctggcccgcaagaactcgtccattcccttcccg
gaccgcgacggcacgccggtcatcgcttatttcagcctggagtacggcatcagccagtgc
ctgccggtctattccggcggcctggggattctggccggcgaccatctcaaatcggccagc
gacctgtgcgtgcccctggtcggcatcgggctgtgctaccagcagggctatttccgccag
tacctcaccccggacggctggcagcaggaacgctaccccatctacgacttcgagcagatg
ccactgaccttgtgcaaggacgaggccggcaatccgttgctcgtccatgtggacctcaag
ggcgagcgggtggcggcccagctgtggaaggcgcaagtcgggcgcgtttcgctctatctc
atggacactaacgtgccggaaaatcagcccggcacgcgccagctcaccaaccgcctctac
ggcggcgacctggaaacccgggtgcgccaggaatacctgctcggcatcggcggcatccgc
gccctggaggtccttggcctcaagcccaaggtcatccacatgaacgagggccattcggcc
ttcgccggcctggagcgcatcgccaacttcatggacaagcaccagctgtccttcgaggcg
gccatggagctggtggcttccagctccatcttcaccacccacaccccggtgccggccggc
aacgaccggtttccgccggaactcatccaggcctatttcgaggactacgccaagcgcctg
ggtctggccttcaaggtgctcttggcccttggccgcgaggacccgcgaaacgacaccgag
catttctgcatgaccgtgctggcgctcaagctctcgcgctttaataacggcgtgtcccag
ctccacggcgaggtctcgcgcaagatgtggaaccgggtctggacccagtatcccatggaa
gacgtgcccatcggggccatcaccaacggcgtccacgtgccgacctgggtggcccaggac
ctggccgccctctacgaccgctacctcggggccaactggcgcgaggacccggacaccacc
cgcgtcttttcccaggcccacctcatctccgacgccgagctgtggcgcacccacgaacgg
ctgcgcgaacggctcatcggctacgtgcgcgagcgtttacgggaccagttgctggcgcgc
ggggccaagcgcaaggaactgcagaccgccgaggaggtcctcgatccccaggcgctgacc
atcggcttcgcccggcggttcgccacctacaagcgggccggcatgctgctccaggacaag
gagcggctcatccgcatcatgtccgacgccaagcgtccggtgcagttcattttcgccgac
aaggcccatccccacgacaacgagggcaagcggctcattcaggaactggtgcagctgtgc
accagcccaacctgccgctacaacatggtttttctcgaagactacgacatggagatcgcc
agctacctcgtccagggcgtggacgtgtggctcaacacgccgcgccggccgctggaggcc
tgcggcaccagcggcatgaaggccatgtgcaacggcgtgctcaacttctcgaccctggac
ggctggtgggccgaggcctggaaacccgacaacagcgtgggctgggccgtgggcatgggc
gaggaatacgaggacgccggctaccaggacttcgtggagagccaaacgctctacaacatc
ctggaaaacgagatcatcccgaccttttacgagcggggccacggcaatctgccgcgcaac
tggattcgcaagatgaaggattccatttgcgagctcacaccggtctacaactcccaccgc
atggtggaggactacgcccgcatcgcctacatcccggccctggagaactacacccgcctg
acgcgcgaggaatgcgccccggccaaggacctggcctcctggcgcatggacatcatgacc
aagtggggcggccttgatgtccgcaacgtgcgggccggcgaccccgagcagctgcacgtg
ggcgacccggtgcgggtgacctgcgaggtgcatctaaacggcatccgcccccaagacgtg
tcggtgcagatctacgccggccggctggacgtggaaggcaagttcgcccagcgcgagacg
gtggacatgcggccggtggagacgacggccgacggctggcatgtctatatgggcgaagtg
cagccctccgaggccgggcgtttcggcttcacggtgcgggtgttgccgcaccatccgctg
ctgctcgactcccacagcctggggctgattcgctgggcccagggggcgtag

DBGET integrated database retrieval system