KEGG   Dehalococcoides mccartyi BTF08: btf_1150Help
Entry
btf_1150          CDS       T02475                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
dmc  Dehalococcoides mccartyi BTF08
Pathway
dmc00061  Fatty acid biosynthesis
dmc00780  Biotin metabolism
dmc01100  Metabolic pathways
dmc01130  Biosynthesis of antibiotics
dmc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dmc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    btf_1150 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    btf_1150 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    btf_1150 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dmc01004]
    btf_1150 (fabI)
Enzymes [BR:dmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     btf_1150 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     btf_1150 (fabI)
Lipid biosynthesis proteins [BR:dmc01004]
 Fatty acid synthase
  Component type
   btf_1150 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase NTase_sub_bind
Motif
Other DBs
NCBI-ProteinID: AGG08226
LinkDB All DBs
Position
1065810..1066649
Genome map
AA seq 279 aa AA seqDB search
MTQTSYGLLKGKKGIIFGPLNEQSLGWKIALACYREGAELAISNVATALKMGNTADLARI
CGQAPLLVADASSDDELKALFSELKTTLGEIDFIVHSVGMSANIRKKIPYESTNYIFYNK
GLEISAISLHKIIRYALEAGVLKDNGSILALTYIGAQRVFSQYNDMNDAKALLEAIARNF
GSRLADRGIRVNTVSQSPTRTSAGSGISNFDAMYEYANLLAPLGNANGEECADYVVTLLS
DLSRKVTMQNLYHDGGFSSAGISEKLLKLLERNQPEAGV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacgtcttacgggttgctcaagggtaaaaagggaattatattcggcccgcta
aatgagcaaagtctgggctggaaaatagccttggcctgctaccgcgaaggagctgagttg
gctatttccaatgtggccaccgcacttaagatgggcaataccgctgacctggcccggatt
tgcggtcaagcccccctgctggtagctgatgccagcagtgacgatgagcttaaagccttg
ttttccgaactgaaaaccacgctgggagaaatagattttatagtccattcggtgggcatg
agtgccaatattcgaaagaaaatcccttacgaatcaaccaattatattttttataacaaa
gggcttgaaatttcggccatatccctccacaaaataatccgatatgcccttgaggccgga
gtactcaaagacaacggcagtatactggctctgacatatattggggcgcaaagggttttt
tcccagtacaacgatatgaatgatgccaaagccctgctggaagcaattgcccgaaatttc
ggttcccgtctggcagaccgcggcatacgggtaaacactgtttcccagtcacctacccgc
acttcggccggttccgggataagcaactttgacgccatgtacgaatatgccaatctgctt
gctccgctgggaaatgcaaacggcgaggaatgtgcggattatgtggttaccctgctttca
gaccttagccgcaaggtaaccatgcaaaacctttaccatgacggcgggttctccagtgca
ggcatctccgaaaaactgctcaagctgctggaacgtaaccagcctgaagccggtgtataa

DBGET integrated database retrieval system