KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10108
Entry
Dmel_CG10108      CDS       T00030                                 

Gene name
phyl
Definition
(RefSeq) phyllopod
  KO
K20233  phyllopod
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG10108 (phyl)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 36606
NCBI-ProteinID: NP_725394
FlyBase: FBgn0013725
UniProt: Q27934
LinkDB
Position
2R
AA seq 400 aa
MSTNQQQQANPSAAVAAPAASSEYLKRTCLICGCHTNQTINIYEPRSGPNIVQLIQAKFK
FQPLNEDKFLCFSCNNWLINWHSLQAVNSNEAESQSQSPSHMGNSVLQQERTKLRPVAMV
RPTVRVQPQSQPQLQPQVPINPTPAPIVYSKRRASRRSASVSRMSRVLRQCCVESLRRSP
KKRNQQSVFVCLRPQGQKRSNAICKVECVAPRRKPVERLVKDVAATATPTPVLNTQSTPT
YQRFPQPSVDGKVVAMFRRLGTTLSREEPAAYSAESNPACSKLPQIMSPLKEAPRWTRDL
DDDEILLEFDTAISEVLPTARYQVTHEENKENQQAQEMELELEEEEEVDGRAELEVVQEA
EAPLEPQSHHKQGNSHQNSHQASIQLAGLRLPMGLSISLV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtctaccaatcagcagcagcaggcgaatccttcggcggccgttgccgcacccgccgcc
tcctcggaatacctgaaacgcacctgcctcatctgcggctgccacaccaaccagacgatc
aatatctacgagccccgctccggacccaatatcgttcagctaatccaggcgaaattcaag
tttcagcccctgaacgaggacaaattcctctgctttagctgcaacaactggctgatcaac
tggcactccctgcaggcggtcaacagcaatgaggccgaaagccagagccaaagtccctcg
cacatgggcaacagtgtgctgcagcaggaaaggacgaagctccgtccggtggcgatggtt
cgacccacggtgcgagtgcagccccaatcgcagccccaactgcagccccaagttccaatt
aatcccacacccgcacccatagtctattcgaagcgaagagccagcagacgcagtgcctcc
gtcagccggatgagccgagtgctgcgccagtgttgtgtggagagtctgcggcggagtccc
aagaagcgcaatcagcagtcggtgttcgtctgtcttaggccgcagggccagaagaggagc
aatgcgatctgcaaggtggagtgtgtggcgccgcgccggaaaccagtggagcgactggtt
aaggatgtggcagctacagctacacccacaccagtgctcaatacacaatccacgcccact
taccaaagattcccgcagcccagtgtggatggcaaagtagtggccatgttccgtcgactg
ggaaccacactcagtcgggaagaacccgccgcatattcagcagaatcaaaccccgcctgc
tcgaaactcccgcagatcatgagtccgctcaaagaggcgccgcgctggacgcgggacctc
gatgatgatgagatactgctggaattcgataccgccatatccgaagtcctgccaactgcc
cgctatcaggttacccacgaggagaacaaggaaaaccagcaggcacaagaaatggagctg
gagctggaggaggaggaagaagtggatggccgagcggaactggaagtggtgcaggaggcg
gaagcgccactggaaccgcagagccaccacaaacaaggaaacagccaccaaaattcccac
caagcttcaatccaactcgctggcctgcgattaccaatgggccttagcattagcctcgtc
taa

DBGET integrated database retrieval system