KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10992Help
Entry
Dmel_CG10992      CDS       T00030                                 

Gene name
CtsB1
Definition
(RefSeq) cathepsin B1, isoform C
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04140  Autophagy - animal
dme04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Dmel_CG10992 (CtsB1)
   04140 Autophagy - animal
    Dmel_CG10992 (CtsB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG10992 (CtsB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG10992 (CtsB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG10992 (CtsB1)
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG10992 (CtsB1)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     Dmel_CG10992 (CtsB1)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C1: papain family
   Dmel_CG10992 (CtsB1)
Chaperones and folding catalysts [BR:dme03110]
 Intramolecular chaperones
  Papain family
   Dmel_CG10992 (CtsB1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dmel_CG10992 (CtsB1)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Haparin
  Others
   Dmel_CG10992 (CtsB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Propeptide_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 32341
NCBI-ProteinID: NP_001259536
FlyBase: FBgn0030521
UniProt: Q9VY87
LinkDB All DBs
Position
X
AA seq 340 aa AA seqDB search
MNLLLLVATAASVAALTSGEPSLLSDEFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGV
HPDAHKFALPDKREVLGDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGA
VEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYG
SNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRR
NVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIP
YWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISAGLPKL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaatctattgctcctggtggccaccgcggcctccgtggcggcactcacgtccggtgag
ccgtcactgctctcggatgagttcatcgaggtggtgcgcagtaaggccaaaacctggacg
gtgggtcgcaatttcgatgcatccgtaacggagggacatattcgccgcctgatgggcgtc
catccggatgcgcacaagttcgcactgcccgacaagcgtgaagttcttggcgatctatac
gtgaatagcgttgacgaacttcccgaagagttcgattcccgcaagcaatggccaaactgc
ccaaccattggcgagattcgcgaccagggttcatgcggctcctgctgggcctttggtgcc
gtggaagccatgtccgatcgcgtgtgcatccattccggcggcaaggtgaatttccacttt
tcggccgatgatctcgtctcctgctgccacacctgcggatttggctgcaatggcggtttc
cccggcgccgcctggagctactggacgcgcaagggaatcgtcagcggaggaccctacgga
tctaatcagggctgccgtccttacgagatttctccctgtgagcaccatgtgaatggaacc
cgaccaccatgtgcccatggcggtagaacgcccaagtgttcgcacgtctgccagagcggt
tacaccgtcgattatgccaaggacaagcacttcggctccaagtcgtactcggtgaggcgt
aatgtgcgtgaaattcaggaggagatcatgaccaatggaccggttgagggcgccttcacc
gtttatgaggatctcattctgtacaaggacggtgtctatcagcacgagcatggcaaggag
ctgggcggtcatgccattcgcattttgggctggggcgtttggggcgaggagaagattccg
tactggctaattggtaactcgtggaacaccgattggggcgatcatggtttcttccgcatc
ctgcgtggccaggatcattgcggcatcgagagctccatttcggcgggtctgcccaagctg
taa

DBGET integrated database retrieval system