KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11630Help
Entry
Dmel_CG11630      CDS       T00030                                 

Gene name
CG11630
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF229 Phosphodiest
Motif
Other DBs
NCBI-GeneID: 35429
NCBI-ProteinID: NP_610124
FlyBase: FBgn0032964
UniProt: Q9V9Q1
LinkDB All DBs
Position
2L
AA seq 631 aa AA seqDB search
MCSCSIRCCFLYSLIIFSFVYYYNDVVVDNIIFEEHHLVEKYSVDTKGCRMLTMVPNEYD
VMFLWRGLRRDFCASNLNLTSFSNCTYNYLRTEVNMELAKARFGVETLESFKCMYYAMER
HTDFDNRYLYSREFELLTDGNNTIEPHADIIRAECFINATSIYNGVHFYVHPTDEWLRTA
QGLPPLKLASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRLGEDGF
DSLMPLLSGLSGQELKDVSSNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLFVKGFRK
PPTDFYLRPALLEMWLKTRTDGLFGTHCNEKDNYAMVLREFLFKMLPHHTSHRFFTFLWW
TQGIDHLFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEES
QPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVD
LWAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNL
NKMIHTHTPPCKTLYLDRVLTADKWRRIADEHQSEFRVRLIATPGEGQFEGIVRYTGYKL
AVDGHISRVNDYRNGSQCIRNYLIEMYCFCP
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcctgcagtatacgttgctgcttcttgtatagcttgattatcttctccttcgtt
tattactacaacgatgtagtggtcgacaacataatcttcgaggagcaccatcttgtggaa
aaatactctgtggacacgaagggctgtcgtatgttgactatggttcccaatgaatacgac
gtaatgttcctgtggcgcggccttcgtagagacttttgcgccagcaacctaaacctgacg
tccttcagcaattgcacctacaactacctgaggacggaagtgaacatggagttggctaaa
gcgaggttcggcgtcgagactttggaaagttttaagtgcatgtattatgccatggagcga
cacaccgatttcgacaatcgctacttgtatagtcgggaattcgagttgctaacggatggt
aataatacaattgagccccatgcggatatcataagggctgagtgctttatcaacgctacg
agcatctacaacggagttcatttttacgttcatccgaccgacgaatggctgcgcaccgcc
cagggtctcccacctctgaagctggcttccgacgtcggcagtttgtcagtgttgatcgtg
ggcctagattctatttcccaaatgcatttccacaggagcatggctcgcacagccaacttt
ctgctatcacttccgcacgtggaacttaaggggttcaatcggttgggtgaggacggcttc
gatagtctgatgccgttgcttagcggtctaagtgggcaggaattgaaggacgtttcgtcg
aacctcagcagtctggacagctgtccttttatctggaaggttttccaaaaagccggctac
gaaacgggcctgggagaggacaacatagacaagagtctgttcgtgaaggggtttcgtaag
ccgccaacagacttttacttacggcctgctcttctagagatgtggctgaaaacgagaacg
gacggattatttggcacacactgcaacgagaaggacaattacgcaatggtgcttagggag
ttcttattcaagatgcttcctcatcatacatcgcacaggttctttacgttcctttggtgg
acccagggcatcgatcacttgtttaactatggacggaaactggaccaaccattcctgaaa
atgttcaaagccataggacggagtggtctgcttaagaacacggtgcttttggtggtttcc
aaccatgggttaaataaaggccgattttacaaaaccgtgcagggcaaagtggaggagagt
caacccctggcgatactttgctaccccaggtggctggaagaacgatatccgcaggccata
ggcaatttaaagagtaacaatcgtcgtctggtcaccgcctttgatttacatgccactctc
cagaacttacctaacctgacctccctggaagatgagcaactgcagcagcgcagagtggat
ttatgggcaatggggaaagacattccgcgaggaataagtcttttcttgcccattccagac
catagagactgtttcttggccgccatacccacggcgaactgcctgtgtcagcagcctaga
aatgtctcgacttcagatggctatgttcagcgggcagcccgtctcattattcgaaacctc
aataagatgatccacacacacactccgccttgcaagactttatacctggatcgggtattg
actgccgataagtggagacgcatcgcagatgagcatcagtcggaatttagggtgcgactg
atagccactcctggcgagggtcagtttgaaggaatcgttaggtatacaggatataagcta
gctgtagacgggcatatatcacgcgttaatgactatagaaatggctcgcagtgcattagg
aactacttgattgaaatgtattgcttttgtccttaa

DBGET integrated database retrieval system