KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12163Help
Entry
Dmel_CG12163      CDS       T00030                                 

Gene name
CG12163
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Dmel_CG12163 (CG12163)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG12163 (CG12163)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     Dmel_CG12163 (CG12163)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C1: papain family
   Dmel_CG12163 (CG12163)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Cystatin
Motif
Other DBs
NCBI-GeneID: 40628
NCBI-ProteinID: NP_730901
FlyBase: FBgn0260462
UniProt: Q9VN93
LinkDB All DBs
Position
3R
AA seq 614 aa AA seqDB search
MRLFAAATVALVLLLGQAAGEELAEERAGQAQGDAESTESSETTTDQAVSEPPITLVHVL
NPGEREYLSPNLIGVQNIAMTFLPLSMNFVNIIDAFREITAGVRYEILLNALDTKAIQPA
EADIVCRLVILEKPWLRTQWGDKHRELVTSNCTDPAVNSVAGDPAEKARLLNEKYVHRSR
RSANDILGRHKPYDEEAAKAQLQKSLDKLTAGEGPHYKIVKVYSASRQVDSGILTRIDAD
LIDGSEEQHRCIVDIWTKVWVRKDEHEITFKCRNQPVVQARHTRSVEWAEKKTHKKHSHR
FDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADM
TSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWA
FSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEY
PYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGV
SHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDN
TCGVSEMATSAVLA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtttgcggcagcaacagttgcgcttgtattgcttctgggccaagcagctggc
gaggagcttgcggaggagcgagcgggacaggcacagggcgatgcggagagcacggaatct
tcagaaacaacaacggaccaggcggtgagtgagcccccgatcacgctggtccacgttctg
aatcccggcgagcgggagtatttgtcacccaacctgattggtgtccagaacattgcgatg
accttcctgccactgtcgatgaactttgtgaatatcatcgacgcctttcgggaaatcacc
gccggagtgcgctatgagatcctgctaaacgcgctagacacaaaggcaatacagccggcg
gaagcggacatagtctgccgcctggtcatcctggaaaagccttggctgcgcacccagtgg
ggcgacaagcaccgcgaactggttacctccaattgcaccgacccagcggtgaactcggtg
gccggagatccggcagagaaggcgcgactgcttaacgagaaatatgtccatcgcagcaga
cgcagcgcgaacgatatcttgggtaggcataagccttacgatgaagaggcggcgaaggcg
cagctgcaaaaatctctggacaaactgaccgcgggagagggtccccattacaaaattgtg
aaagtatactcagcctcgcggcaagtggattcaggcatcttgacccgcatcgatgcggat
ctaatcgacgggtcggaggagcagcaccgctgtatcgtggatatctggacaaaggtctgg
gtgaggaaggatgagcacgaaatcacctttaagtgccgcaaccagccggtggtccaggcc
cgacacacgcgatccgtggagtgggccgagaagaagacgcacaagaagcacagccatcgc
tttgacaaggtggaccacctcttctacaagttccaggtgcgatttggccgtcgctacgta
agcaccgccgagcgccagatgcgcctgcgcattttccgtcagaacctgaagactatcgag
gagctaaacgccaacgagatgggcagcgccaagtacggcatcacggagtttgctgatatg
accagctcggaatacaaggaacgcacgggactctggcagcgtgatgaggcaaaggccact
ggcggatcggcggctgtcgtaccggcttaccatggtgaactgccgaaggagtttgactgg
aggcagaaggatgctgtcacccaggtgaagaatcagggatcctgcggttcatgctgggcc
ttcagtgtgaccggcaacatcgaaggcctgtacgcagtgaaaacgggcgaattgaaagag
ttctccgaacaggagctgctggactgtgataccacggatagtgcctgcaacggcggcctc
atggacaatgcttacaaggccattaaggatattggcggcctagagtacgaggctgagtac
ccatacaaggccaaaaagaatcagtgccacttcaacaggactttgtcccacgttcaggtt
gccggcttcgtggatctgccgaagggaaatgagaccgccatgcaggagtggcttctcgcc
aatggtcccatttcgatcggcatcaatgcgaatgctatgcagttctatcgcggcggagtt
tcccatccgtggaaggccctgtgctccaagaaaaacctcgaccacggtgttctagttgtg
gggtatggcgtctccgactatcccaatttccacaagaccttgccctactggattgtgaag
aactcgtggggtccgcgctggggagagcagggctattatcgcgtttatcgtggtgacaac
acttgcggcgtcagcgaaatggccacttcggctgtgctggcctag

DBGET integrated database retrieval system