KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12345Help
Entry
Dmel_CG12345      CDS       T00030                                 

Gene name
ChAT
Definition
(RefSeq) choline acetyltransferase, isoform A
  KO
K00623  choline O-acetyltransferase [EC:2.3.1.6]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmel_CG12345 (ChAT)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.6  choline O-acetyltransferase
     Dmel_CG12345 (ChAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 42249
NCBI-ProteinID: NP_477004
FlyBase: FBgn0000303
UniProt: P07668
LinkDB All DBs
Position
3R
AA seq 721 aa AA seqDB search
MASNEASTSAAGSGPESAALFSKLRSFSIGSGPNSPQRVVSNLRGFLTHRLSNITPSDTG
WKDSILSIPKKWLSTAESVDEFGFPDTLPKVPVPALDETMADYIRALEPITTPAQLERTK
ELIRQFSAPQGIGARLHQYLLDKREAEDNWAYYYWLNEMYMDIRIPLPINSNPGMVFPPR
RFKTVHDVAHFAARLLDGILSHREMLDSGELPLERAASREKNQPLCMAQYYRLLGSCRRP
GVKQDSQFLPSRERLNDEDRHVVVICRNQMYCVVLQASDRGKLSESEIASQILYVLSDAP
CLPAKPVPVGLLTAEPRSTWARDREMLQEDERNQRNLELIETAQVVLCLDEPLAGNFNAR
GFTGATPTVHRAGDRDETNMAHEMIHGGGSEYNSGNRWFDKTMQLIICTDGTWGLCYEHS
CSEGIAVVQLLEKIYKKIEEHPDEDNGLPQHHLPPPERLEWHVGPQLQLRFAQASKSVDK
CIDDLDFYVYRYQSYGKTFIKSCQVSPDVYIQLALQLAHYKLYGRLVATYESASTRRFLH
GRVDCIRAASTEALEWAKAMCQGEGANVPLESDREDEEESRKVKFSIYSKDHLRELFRCA
VARQTEVMVKNILGNGIDIPLLGLREASIEVTGEMHELFKDESYIISQCFLLSTSQVACS
TDSFMGYGPVTPRGYGCSYNPHPEQIVFCVSAFYSCEDTSASRYAKSLQDSLDIMRDLLQ
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtccaacgaggccagcaccagcgcagcgggcagtggcccggagtccgccgccctg
ttctccaagttgcgtagcttctccattggcagcgggccgaactcgccgcagcgcgtcgtc
tccaatctccgaggattcctcacccatcgcctcagcaacatcacaccgagcgatacagga
tggaaagactcgattctgtcgataccaaagaaatggctctcaacggccgagtctgtggac
gagtttggattccctgacactctacccaaggtgcccgttccagcactggatgaaacgatg
gccgactatatccgcgccctggaaccgattaccacgccggcgcagctcgagcggaccaag
gagctgatcaggcagttctcggctccccagggaatcggagcgcggctgcatcagtatctg
ctggacaagcgtgaggcggaggataactgggcctattactactggctcaacgagatgtac
atggatattcgcatccctttgccgatcaactcgaatccgggcatggtgttcccgccgcgt
cgcttcaagaccgtccacgacgtggcccacttcgccgctcgcctgctggacggcattctg
agccaccgcgagatgctggacagtggggagctgccgctggagcgggccgcctcgcgggaa
aagaatcagccgctgtgcatggcgcagtactaccgcctgctgggctcctgtcgtcggcct
ggtgtcaagcaggactcgcagttcctgccgtcgcgggagcgactgaacgacgaggatcgc
catgtggtggttatttgccgcaaccaaatgtattgcgtcgtgctgcaggctagcgatcgt
ggaaagttgtcggagagtgagatcgcctcacagatcctctatgtgctcagtgatgctccc
tgtctgccagctaaaccagtgccggtgggtctgctgaccgctgagccgaggagcacgtgg
gcacgggaccgggaaatgcttcaggaggacgaacgcaatcaacgcaatctggagctcatc
gagacggcacaggtggtcctctgtctggacgaaccgctggctgggaactttaatgcgcgc
ggttttacgggtgccacgcccacagttcatcgggcgggggatcgggacgagacgaacatg
gcccatgagatgatccacggcggaggcagcgagtacaattccggaaatcgctggtttgac
aagaccatgcagctcattatttgcaccgatggaacctggggcctttgctatgagcactcc
tgttccgaaggcattgctgttgtccagctgctggagaagatctacaaaaaaatcgaggag
cacccggacgaggataacggtctaccgcaacaccacttgccaccaccggagcgtctggag
tggcatgtgggtccgcaattgcaattgcgctttgcccaagcctccaagagtgtggacaaa
tgcatcgatgacctggacttctatgtgtaccgctaccagagttacggaaagacctttatc
aaatcgtgccaggtcagtccggatgtgtacattcaactggccctgcaactggctcactac
aagctgtacggacgtctggtggccacctacgaaagtgcgtccactcgacgatttctgcac
ggtcgcgtagactgcatcagagcggccagcacggaggcattggagtgggccaaggccatg
tgccagggtgagggtgcaaacgtgcccctggagagcgatcgcgaggatgaggaggagtcg
cgaaaggtcaagtttagcatttacagtaaggatcatctccgggagcttttccggtgcgcc
gtcgcccgccagactgaggtgatggtgaagaacatcctgggcaatggcatcgacatcccg
ctgctgggcctgcgagaggccagtatagaggtcaccggcgagatgcacgagctgttcaaa
gacgagtcctacatcatctcgcagtgcttcctgctctccaccagtcaggtggcctgctct
acggacagcttcatgggatacggaccggtaacgccacgtggttatggctgctcctacaat
ccgcatccggaacagatcgtcttctgcgtctcggccttctactcctgtgaggatacgagt
gcctcgcgctacgccaaatcgctgcaggactcgctggacataatgcgtgatctactgcaa
aactag

DBGET integrated database retrieval system