KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12512Help
Entry
Dmel_CG12512      CDS       T00030                                 

Gene name
CG12512
Definition
(RefSeq) uncharacterized protein
  KO
K23617  medium-chain acyl-CoA ligase, mitochondrial [EC:6.2.1.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dme01004]
    Dmel_CG12512 (CG12512)
Enzymes [BR:dme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  medium-chain acyl-CoA ligase
     Dmel_CG12512 (CG12512)
Lipid biosynthesis proteins [BR:dme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dmel_CG12512 (CG12512)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-GeneID: 33766
NCBI-ProteinID: NP_608924
FlyBase: FBgn0031703
UniProt: Q9VMR6
LinkDB All DBs
Position
2L
AA seq 593 aa AA seqDB search
MNSKLQTISRYMLRQKCAFNSMRSISTSMPSLISHKHHIGKDPLVYRTIGQQLELSASNF
GDVEAIVSCHEGKRYSFKSLLQEADALAAGFRKLGLQPGDAVGLWAPNYLHWYLGMMGAA
RAGLTSVGLNPAYQGPEIAYCLNKVNVKAIIAPETFKTQNYYEILRDICPEISDADTGKI
RSEKFPHLRSVIIDSNDSLKGALRFDDFLDLASKSEREEVAKMQKSILPESACNIQFTSG
TTGNPKAACLTHHNFVNNGIHVGNRNELEGERICVQVPMFHAFGVIISIMAALTKGATMV
LPAAGFSPKDSLQAIVNEKCSVIHGTPTMYVDLVNTQKKLQVPLGRIKKAVTGGAIVSPQ
LIKDVRQVLNVEAVHSVYGLTETTAVIFQSLPGDSSDVVLNSVGHLTDHIEAKVVDAEGR
CVPFGQPGELCVRGYTTMLGYHDDEEKTKETIGNDRWLRTGDQFVLEANGYGRIVGRLKE
MLIRGGENIFPKEIEDFLNAHPQVIEAHVIGVPDERLGEEVCAYVRLEEGVDPASFTAET
LKAYAKGKLAHFKVPRYVIPIDAFPKTTSGKIQKFKLVEAFKAKETELKAARL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaagctgcagaccatctcccgatacatgctcaggcagaaatgtgccttcaac
tcgatgcgcagcatttccacctcgatgcccagcttgatcagccataagcatcatattggt
aaggatcccttggtatatcgcaccattggccagcagttggagctatctgcttcgaatttt
ggggatgtggaggcgattgtctcctgtcacgagggcaagcggtacagcttcaaaagtttg
ctacaggaagcggatgcgctggcggcgggtttccggaaattgggcctgcagccaggtgat
gccgttggtctgtgggcaccgaactacttgcactggtacttgggcatgatgggagcagct
cgagcgggtctcacctcggtgggtttgaatccagcttaccagggacccgaaatagcctac
tgtctgaataaggtcaatgtgaaggccatcattgcgccggagaccttcaagacgcagaac
tactatgagattttgagagatatctgcccggaaatctcagatgcggatactggcaagatc
cggagtgagaagtttccgcacctgcgatccgtaatcattgatagcaacgatagcctgaag
ggtgccctgcgcttcgatgacttcctggacctggccagcaaatcggagcgcgaagaggtg
gccaaaatgcagaagagcattctgcccgagtctgcgtgcaatattcagttcacatcggga
accactggcaatcccaaggctgcctgtcttacccatcacaatttcgtcaacaatggcatc
catgtgggcaatcgcaacgaactggagggcgagaggatctgtgttcaggtgcccatgttc
catgccttcggtgtgatcatctccatcatggctgctctgaccaaaggtgccaccatggtc
ctacccgctgccggtttcagtcccaaggactcgctgcaagccatcgtcaatgaaaagtgt
tcggtgatccatggcacaccaaccatgtatgtggatttggtcaacacgcaaaagaagcta
caggtgccgctgggcaggattaagaaggccgtcaccggaggtgccattgtatcgccgcag
ctgatcaaggatgtgagacaggttctcaacgtggaagcggtgcatagtgtctatggcctg
acggaaaccacagctgtgatcttccaatccttgcccggcgatagcagtgatgttgtcctc
aactcagttggccatctgacggatcacatcgaagccaaggtggtggatgccgagggcagg
tgtgtgccatttggacagcccggagagctgtgcgtccgcggatataccacaatgctgggc
taccacgatgatgaggagaaaacaaaggaaaccatcggtaatgataggtggttgcgcacg
ggcgatcagtttgtcctggaggccaatggatatggacggattgtgggtcgcctaaaggag
atgctcatccgtggcggcgaaaatatattccccaaagagatcgaagactttctaaacgcc
catccacaggtcattgaggcgcatgtgattggagtgcctgatgagcgattgggtgaagaa
gtctgcgcctatgttcgcctggaggagggcgtggaccccgcctccttcaccgcggagacc
ttaaaggcctatgccaagggcaagctggcccacttcaaggtgcccagatatgtgatcccc
atagatgcattccctaaaaccacctcgggcaagatccagaaattcaagctagtggaggct
ttcaaggccaaggaaacagagctaaaagctgccagactatga

DBGET integrated database retrieval system