KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12598
Entry
Dmel_CG12598      CDS       T00030                                 

Gene name
Adar
Definition
(RefSeq) adenosine deaminase acting on RNA, isoform I
  KO
K13194  double stranded RNA-specific editase B [EC:3.5.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG12598 (Adar)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.-  Acting on carbon-nitrogen bonds, other than peptide bonds
    3.5.-.-  
     Dmel_CG12598 (Adar)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    Dmel_CG12598 (Adar)
SSDB
Motif
Pfam: A_deamin dsrm Herpes_LAMP2
Other DBs
NCBI-GeneID: 31130
NCBI-ProteinID: NP_001245469
FlyBase: FBgn0026086
UniProt: Q9NII1 M9NFQ6
LinkDB
Structure
PDB: 
2LJH

Position
X
AA seq 632 aa
MLNSANNNSPQHPVSAPSDINMNGYNRKLPQKRGYEMPKYSDPKKKMCKERIPQPKNTVA
MLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFIQ
FKDGAVLSPLKPAGNLDFTSDEHLENDVSKSAITVDGQKKVPDKGPVMLLYELFNDVNFE
CINIDGAQNNCRFKMTVTINEKKFDGTGPSKKTAKNAAAKAALASLCNISYSPMVVPQKN
VPLPIDDKSSSMELPQIHADTIGRLVLEKFMEVIKGQEAYSRRKVLAGIVMTENMNFCEA
KVISVSTGTKCVSGEHMSVNGAVLNDSHAEIVSRRCLLKYLYAQLDLQCNQATAYQSIFV
RNTDGQYPYKLKSGVHFHLYINTAPCGDARIFSPHENDTGVDKHPNRKARGQLRTKIESG
EGTIPVKSSDGIQTWDGVLQGQRLLTMSCSDKIARWNIVGIQGSLLSSIIEPVYLHSIVL
GSLLHPEHMYRAVCGRIEKSIQGLPPPYHLNKPRLALVTSAEPRNQAKAPNFGINWTIGD
TELEVVNSLTGRTIGGQVSRITKQAFFVKYGFLMANLPGILVRKVTTDYGQTKANVKDYQ
IAKLELFSAFKREDLGSWLKKPIEQDEFGLAE
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgttaaacagcgctaataacaattctccccagcacccggtgagtgcaccatccgatatc
aacatgaatggctataaccgaaaattgccacaaaaacgtggctatgagatgccaaaatac
tctgatccaaaaaagaaaatgtgcaaggagcgcattccccagccgaagaacacggtggcc
atgctgaatgagctaagacatggactgatttacaaattggagtcacagactggtccggta
cacgcacctctattcacgatatccgtggaggtcgatggacagaaatacttgggccagggc
cgtagtaaaaaagttgcacgcatcgaagcagcagcaactgcactgcgcagctttatacag
tttaaggatggagcagttctgtcgcctctgaagccggcgggcaacttggactttaccagc
gatgaacatcttgaaaatgatgtcagcaaaagtgctattactgttgacggtcagaagaag
gttccagataagggtcctgtcatgctcctctacgaattatttaatgacgttaatttcgaa
tgcattaatattgacggcgcccagaacaattgtcgcttcaaaatgaccgtcacaatcaac
gaaaagaagttcgatggaacaggtccttccaaaaagacggcgaaaaatgcggcagctaag
gcggcacttgcttcgttatgcaatatttcctacagtccaatggtggtgccacagaagaac
gtacccctgccaatcgacgacaagtcgtcatcgatggagttgcctcagatacacgcggat
acgattggtcggttggtcttagaaaagttcatggaagtaatcaagggccaggaggcttac
tcgcgtcgaaaggtattagcgggcattgtaatgactgaaaacatgaatttttgtgaagcc
aaagttatttcagtttcgacgggcaccaagtgtgtcagcggtgagcatatgagtgtgaac
ggagctgtcctaaatgattcccatgctgaaatagtctccaggcgttgtcttctcaaatat
ttatatgcacagctggaccttcagtgcaatcaggccacagcatatcagtcgattttcgtg
aggaatactgatgggcaatacccttataaactaaaatccggggtacatttccatttgtat
ataaatacagcaccttgtggggatgcacggatatttagtcctcacgaaaacgacactggt
gttgataaacatccaaatagaaaagctcgtggccagctgcgcaccaaaatcgagtccggt
gaggggacgattccagtgaaaagcagtgatggtatccagacgtgggatggcgtattgcag
ggccaacgcctgctaacaatgtcgtgctcggataaaattgcccgttggaacatcgtgggc
atccaaggctcactattgtcttccataattgaaccggtgtacctgcattcgattgtgctg
ggaagcctgttgcatccggagcacatgtaccgcgcagtttgcggccgaattgagaagtcc
attcaaggcctgccaccgccgtaccatctgaacaagccgcgcctggcactagtcacttcg
gccgagccgcggaatcaggccaaggctcccaacttcgggatcaattggaccattggggac
accgagctggaagtggtgaactcgctaaccggtcgaaccattggcggccaggtgtctcgc
atcacaaagcaggcgtttttcgttaagtatggatttctaatggcaaacttgcccggtatt
ttagtccgcaaagtaaccactgactatgggcaaaccaaagctaacgttaaggactatcag
atcgcaaagctagaattgttctctgcattcaagcgagaagaccttggcagctggctgaag
aaacccattgaacaagacgagttcggtcttgccgaatga

DBGET integrated database retrieval system