KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12753
Entry
Dmel_CG12753      CDS       T00030                                 

Gene name
ema
Definition
(RefSeq) endosomal maturation defective, isoform A
  KO
K19513  protein CLEC16A
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG12753 (ema)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG12753 (ema)
Membrane trafficking [BR:dme04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    Dmel_CG12753 (ema)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    Dmel_CG12753 (ema)
SSDB
Motif
Pfam: FPL
Other DBs
NCBI-GeneID: 41992
NCBI-ProteinID: NP_650542
FlyBase: FBgn0038427
UniProt: Q9VEV4
LinkDB
Position
3R
AA seq 1067 aa
MFRSRSWFGGPWGGRPKNRLSLEHLKYLYSILEKNTTVSESNRGLLVESLRCIAEILIWG
DQHDSLVFDFFLEKNMLSYFLHIMRQKSGGSSFVCVQLLQTLNILFENIRNETSLYYLLS
NNHVNSIMVHKFDFSDEDVMGYYILFLKTLSLKLNTHTIHFFYNEHTNDFPLYTEAIKFF
NHPESMVRIAVRTISLNVYKVQNPSMLRFIRDKTAAPYFSNLVWFIGKHILELDTCVRTD
IDHQSNQKLSNLVAEHLDHLHYLSDILLLEIKDLNAVLTEHLLHKLFVPLYIFSLTPAPP
PPSLAVVTQNLAAVLNRNVDIDIQEMHNPRVSSIVALFLLSLVFLVVSHAPLVHALAWVI
LNGDHSVFKEGAAEILNSYVEHREVVVPGFGEPDESLEQALDTVTGQSSSSSYALSEDSG
VESSSPATTELDSQADAVEAEQIKLRNITDEEKQLLQKSSSSTKADFAEMAKPFLDTVLH
ALDCTENDYLALLSLCLIYAMSHNRGIKNEWFEQVLAKSTRGAFSYKTALIEHLLNIITQ
SSQPSSRIRLITVEIALELLVTFTRPSSDDSRCITAAQQDLLFSARNQSMVVIRNFYKSE
DIFLDLFEDEYNEMRKAQLNVEFLCMDSTILLPPTGTPLTGINFTRRLPCGEVEKARRAI
RVYFLLRRTCQKFLNEKESLLPLTNVVNLVQVENVLDLNNSDLIACTVVAKDSSKQRRFL
VIDALQLILVEPDAKLLGWGVAKFVGFLQDVEVQGDKDDSRCLHITVHRGGVTHNRTPLL
SAKFLFDDHIRCMAAKQRLTKGRSKARQKKMYQIAQLIEIPGQMDSPVYAVGGTMVASSS
GGSGNSSGSSSRSSHHRPMFSTANRVPGFAAVLRGSNSAGVSRTQMAPNRSIEGIRNESA
GRSRRRSPSSTSGSNLRADHSDRERSPSVSMGSHSSSQSRENSQPRSTGNRSRESSPRMP
RPRSEEIPLEDFQHSRNNSPHSRGNPSPASRSHTPIRVLHYDQLSGHSGSPREASLGGTN
ALLSQLNGLNREVLPTQSSEETSFIGSDGNEATGGSEGRRRGAIETV
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgttccggagtcgcagctggtttggcggaccctggggtgggcggcccaaaaaccgcttg
tcgctggagcaccttaagtacctgtacagcattctggagaagaacaccaccgtgtcggaa
agtaatcgtggcctgctggtggagtcgctgcgctgcatcgcagagatcctgatttggggc
gaccagcatgactcgctggtgtttgacttcttcttggagaagaatatgctatcgtatttc
ctgcacataatgcgacaaaagagtggaggctcgagtttcgtctgcgtgcagctccttcag
actctcaacatcctctttgagaacatacgcaacgagacgtccctgtattatctgttgagc
aacaaccatgtaaattctatcatggtgcacaagtttgacttctccgacgaggatgtgatg
ggctattatatactttttttaaagacgctaagtctaaagttaaacactcacacaatacac
ttcttttacaatgagcacacaaatgactttcccttgtatacagaggctattaagttcttt
aatcatcccgagtcaatggtgagaattgcagtgcgcaccatttccttaaatgtctacaag
gttcaaaatccaagcatgttgcgttttattcgagacaaaacggctgctccatatttcagt
aatctggtctggtttatcggcaaacacattcttgaactagacacttgtgttcgcacagat
atagaccatcaatcgaatcaaaagctgtccaatttggttgccgagcatctggatcatttg
cattatttgagtgacattcttctactggaaatcaaggatctgaacgcggtgttaaccgag
cacttgctgcataagctattcgtgcctctgtacatattctcacttacaccagctccgccc
ccgccctcactggcagtggttacccagaatctagctgctgtgcttaatcgcaatgtggac
atcgacatacaggagatgcacaatccgcgagtgagctccatcgtggcccttttcctgctc
tcattggtcttcctggtggtttcgcatgcccctctggtgcacgctctggcctgggttatc
ctcaatggtgaccacagcgtttttaaggagggtgcagccgagattcttaattcatacgtt
gagcaccgcgaggtggttgtgcctggcttcggcgagcccgacgagagtctcgaacaggcc
ttggatacagtcaccggtcagtccagctcgtccagctatgcccttagcgaggacagtggc
gtggagtcctcatccccagccaccacagaactggactctcaagcagatgcggttgaagcg
gagcagattaaactgcgcaacataactgacgaggaaaagcagctgctgcagaagtcatct
tcctcaacgaaggctgactttgctgagatggccaaaccgtttttagacacggtcctgcat
gctttggactgcaccgaaaacgattaccttgccctgctgtcgctgtgcctcatatatgct
atgtcgcacaatagaggcatcaagaatgagtggttcgagcaggttcttgcaaaatcaacc
cgtggcgccttcagttataagacagccttgattgagcatctgttaaacatcatcacccag
tccagtcagccatcgtcccgcattcggttgattaccgtggagattgccttggagttactg
gtcactttcacccgtcccagctcggatgattcgcgctgcataaccgccgcacaacaggat
ctgctcttcagcgcccgcaatcagtcgatggtggtgatccgtaacttctacaagtcggag
gacatcttcctagacctgttcgaagacgaatacaacgagatgcgaaaggcgcaactgaac
gtggaattcctgtgcatggactccaccattctactgcctcccacgggaacgccacttact
ggaatcaactttacgcgacgacttccctgcggggaggtggaaaaggcacgccgagccatt
cgcgtttacttcctgctgcgtcgcacgtgccaaaagtttttgaatgagaaggaatcgcta
ttgccgcttacaaatgtagtcaatctggttcaggtggagaacgtactcgatctgaacaat
agtgatctaatagcctgcaccgttgtggccaaggacagcagcaagcaaagacgctttctg
gtcattgacgcattgcagctaattctcgtcgagccggatgcaaagctgcttggctggggc
gtggcaaagttcgttggctttctgcaggacgtagaggtgcagggtgataaggatgactcg
cgctgcttgcacatcaccgtgcaccggggcggagtcactcacaaccgcactccgttgctc
tcggctaagttcctgttcgacgatcacatccgttgcatggctgccaagcagaggttgaca
aagggtcgtagcaaggcgcgacaaaagaagatgtaccagattgcgcaactcatcgagatt
cctggacagatggactctcccgtctacgctgttggtggcacaatggtcgcatccagtagc
ggcggaagtggtaacagcagtggcagcagttcgcgcagtagtcaccaccgtcccatgttc
tccacggccaatcgagtgccgggatttgcagcggtgctgcgtggaagcaatagcgctggg
gttagtcgaacccagatggccccgaatcgatccatcgaaggaattagaaatgaaagcgct
ggccgctcccgacgccgcagtcccagctcaacttcgggctcgaatcttagggccgatcac
tcggatcgggagcgatcgcccagtgttagcatgggcagccacagctcctcgcagtctcgg
gaaaactcccagcccagaagtactggaaatcggtcgcgggagagcagccctagaatgccc
aggccgcggtcggaggagattcctctcgaggacttccagcactcacggaacaacagtccg
cactctcggggaaacccctcgcctgcctcccgctcacacacacccatccgcgtgctccac
tacgatcagctgtccggtcatagcggctcaccacgtgaagcgtccctggggggaactaac
gccctgctaagccagttaaatgggctgaaccgtgaagtgctcccaacgcagagctccgag
gagacttcttttattgggagcgacggaaacgaggccactggcggatcggagggcaggcga
cggggggccatagagacggtttaa

DBGET integrated database retrieval system