KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12763
Entry
Dmel_CG12763      CDS       T00030                                 

Gene name
DptA
Definition
(RefSeq) diptericin A
  KO
K20669  diptericin
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG12763 (DptA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG12763 (DptA)
Transporters [BR:dme02000]
 Other transporters
  Pores ion channels [TC:1]
   Dmel_CG12763 (DptA)
SSDB
Motif
Pfam: Attacin_C
Other DBs
NCBI-GeneID: 37183
NCBI-ProteinID: NP_476808
FlyBase: FBgn0004240
UniProt: P24492 A0A1B2AKR6
LinkDB
Position
2R
AA seq 106 aa
MQFTIAVALLCCAIASTLAYPMPDDMTMKPTPPPQYPLNLQGGGGGQSGDGFGFAVQGHQ
KVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF
NT seq 321 nt   +upstreamnt  +downstreamnt
atgcagttcaccattgccgtcgccttactttgctgcgcaatcgcttctactttggcttat
ccgatgcccgacgacatgaccatgaagcccactccaccaccgcagtacccactcaatctt
cagggaggcggcggtggccagagcggcgatggttttggctttgcagtccagggtcaccag
aaggtgtggaccagcgacaatggacgccacgagattggactgaatggaggatatggacag
cacttgggaggaccatatggcaactcagaaccgagctggaaagtgggaagcacctacacc
tacagatttccgaatttctaa

DBGET integrated database retrieval system