KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12891Help
Entry
Dmel_CG12891      CDS       T00030                                 

Gene name
whd
Definition
(RefSeq) withered, isoform C
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00071  Fatty acid degradation
dme01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dmel_CG12891 (whd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG12891 (whd)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     Dmel_CG12891 (whd)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dmel_CG12891 (whd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 36109
NCBI-ProteinID: NP_001163111
FlyBase: FBgn0261862
UniProt: Q9V3K9
LinkDB All DBs
Position
2R
AA seq 782 aa AA seqDB search
MAEAHAAVAFSFAITHEGFDINYDHEVLNLVWNSGVRSWKKRLARARNGVRNGVYPAHIQ
SLWLISAIALGLHFAGYQAPFNLTNRILVHLPSNTINWQVTACFLAALVVWLSICFTMRY
TLKLLLMYKGWMYESRAPGSRVSLPTMLWVAVVRVLSSWNKPGLYSFQGSLPRLPLPSVK
DTMTRYLRSVRPLLDDENYTRMERLAKEFEQTIGKKLQWYLILKSWWSTNYVSDWWEEYV
YLRGRSPLCVNSNFYGTDAIFMNLTDKQAARAANVISLLLNFRRLIEHQELQPIMVQGMI
PLCSWQYERTFNTARVPGLETDRIIHYRDSNHIVVLHKGCYYKMLIYYKGRILRPCELQV
QIEEILKGKATPVEGEEHLAALTAWNRSKWAEARNTFFSWGVNQTSLRTIESAAFVLSLD
DEPFEFDLARPELLDNFGKKLLHGNGYNRWFDKCFTVCVGTNGRVGFNAEHTWSDAAIAS
HMWENLIVDDLVSDGYDETGNTKGTPAFQPPTPTRLTWDLKPCLAQIEEATIDVTKLINE
VNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLTYEASMTRLFREGRTE
TVRPCTIESSAWVKAMQNPNTTNDERVKMMQAACDRHQLGYQDAMCGRGIDRHLFCLYVV
SKYLEVDSPFLNEVLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGGFGPVADDGYGVS
YIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSMFEQHMKDHPKPAKSLTNGK
ST
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcccatgccgccgtggcattctcgtttgccatcacccatgagggcttcgac
atcaactatgaccacgaggtgctcaatttggtgtggaactcaggagttcgttcctggaaa
aagcgattggctcgcgcaaggaacggcgtacgcaatggcgtctatccggctcacatccag
agcctctggttgatctcagcaatagcgctgggtctacactttgcgggctaccaggctcca
ttcaatctgaccaaccgtatactggtgcacctgccttccaacacgataaactggcaggtt
accgcctgctttttggccgctctggtggtctggctatcgatctgtttcaccatgagatac
actctcaagctgctgctcatgtacaagggctggatgtacgagtccagagctcccggtagt
cgtgtctctctgcccaccatgttgtgggtggcagtggtgcgggttctatctagttggaac
aaaccgggtctgtacagcttccagggttctctgcccaggctgccactgccctccgttaaa
gacacgatgaccaggtacttgcgcagtgttcgaccgctgcttgatgatgagaactacacg
cgcatggagcgcctggccaaagaattcgaacagaccatcggcaagaagctgcagtggtac
ctcatcctcaagagctggtggtccaccaactacgtgtcggattggtgggaggagtacgtc
taccttcgtggtcgcagtcccctctgcgtgaacagcaacttctacggcacggatgcgatc
ttcatgaacctcaccgacaaacaggcggcgcgtgcggccaatgtgatttccctgcttctc
aacttccgtcgacttatcgagcaccaggaactgcagcctatcatggttcagggcatgatt
cctctgtgctcctggcagtatgaacgtaccttcaacacagcacgcgtgccaggcctggaa
accgatcgtatcatccactacagggactccaatcacattgtggttctccacaagggctgc
tactacaagatgctcatctactacaagggtcgcatcctgcgcccatgcgaattgcaagtg
caaattgaggaaatcctgaagggcaaagcaactcccgtggaaggtgaggagcacttggct
gccctgaccgcctggaatcgctccaagtgggcggaagctcgcaacacattcttctcgtgg
ggagtcaatcaaacctctctgcgcaccatcgagtcggccgcttttgtgctctccctggat
gatgagcccttcgagttcgatttggcgcgaccggaattgctggacaactttggcaagaag
ctgctgcacggcaatggctacaaccgctggtttgacaagtgtttcactgtctgtgtgggc
accaatggtcgcgttggcttcaatgccgaacacacctggtccgacgctgccatcgcgtca
cacatgtgggagaacctgatcgtcgatgatcttgtatcggacggatatgacgaaacgggt
aatacaaagggcaccccggcgttccagccacccacgcccactaggctcacttgggatctt
aaaccatgcctggcgcagatcgaagaggccaccatcgatgtgacgaagcttatcaacgag
gtcaatctgcgcatcctggtgcaccaggattacggcaagggctttatgaagaagtgccgc
atctcaccagatgcctacatacaaatggccctgcagttggcctactaccgagatgccggt
cgcttctcgttgacatatgaggcttcaatgacccgtctgttccgcgaaggaagaactgag
acagtgcgtccgtgcaccattgagtcatccgcctgggtcaaggccatgcagaacccaaat
acaaccaacgatgagcgtgtgaagatgatgcaggctgcctgcgatcgtcaccagttgggc
taccaggatgccatgtgcggtcgtggcatcgacaggcatctgttctgcctgtatgtggtc
tccaagtacctggaggtggattcacccttcctcaacgaggtgctcagcgaaccctggcgc
ctctctactagtcagactccgcacggccagacgcccaagatggacctgaagaagcatccg
aactgcatcagcgctggaggcggctttgggcccgtggccgatgatggttacggtgtgtcg
tacattattgccggagagaacctgatattcttccatatctcagcgaagactacgtgccag
caaacggatgtgcaccgcttcgctcagaacatatcgcaggctctgtcagacattcgcagc
atgttcgagcagcacatgaaggaccatccgaagcccgccaaatcactcacaaacggcaaa
tccacataa

DBGET integrated database retrieval system