Drosophila melanogaster (fruit fly): Dmel_CG14167 Help Entry Dmel_CG14167      CDS       T00030                                  Symbol Ilp3 Name (RefSeq) Insulin-like peptide 3   KO K04526   insulin Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04068   FoxO signaling pathway dme04140   Autophagy - animal dme04150   mTOR signaling pathway dme04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     Dmel_CG14167 (Ilp3)    04150 mTOR signaling pathway     Dmel_CG14167 (Ilp3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     Dmel_CG14167 (Ilp3)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     Dmel_CG14167 (Ilp3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dme04052]     Dmel_CG14167 (Ilp3) Cytokines and neuropeptides [BR:dme04052]  Neuropeptides   Neuropeptides (Unclassified)    Dmel_CG14167 (Ilp3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  39151 NCBI-ProteinID:  NP_648360 FlyBase:  FBgn0044050 UniProt:  Q9VT52 E7BBS2 LinkDB All DBs Position 3L Genome browser AA seq 120 aa AA seqDB search MGIEMRCQDRRILLPSLLLLILMIGGVQATMKLCGRKLPETLSKLCVYGFNAMTKRTLDP VNFNQIDGFEDRSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYCAAKPRT NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgggcatcgagatgaggtgtcaggacaggaggatcctgctacctagcctactcctacta atccttatgatcggcggtgtccaggccaccatgaagttgtgcggccgcaaactgcccgaa actctctccaagctctgtgtgtatggcttcaacgcaatgaccaagagaactttggacccc gtgaacttcaatcagatcgatggcttcgaagaccgttccctgctggaaagactgttgagt gatagttcggttcagatgctcaagactcgacgtcttcgggatggagtcttcgacgagtgt tgcctgaagtcgtgcaccatggatgaggtgctgagatattgtgctgccaagccgagaacg taa

DBGET integrated database retrieval system