KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14407
Entry
Dmel_CG14407      CDS       T00030                                 

Symbol
CG14407
Name
(RefSeq) uncharacterized protein
  KO
K07390  monothiol glutaredoxin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG14407 (CG14407)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG14407 (CG14407)
Chaperones and folding catalysts [BR:dme03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dmel_CG14407 (CG14407)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Dmel_CG14407 (CG14407)
SSDB
Motif
Pfam: Glutaredoxin SH3BGR
Other DBs
NCBI-GeneID: 32410
NCBI-ProteinID: NP_572974
FlyBase: FBgn0030584
UniProt: Q8SXQ5
LinkDB
Position
X:complement(14837471..14838198)
AA seq 159 aa
MNRICQSLRHPRYQILATTAPQSLLTRFLAADAATGAAVDKATMDKLVRTNKVVVFMKGN
PQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGVKDYTDWPTIPQVFINGEFVGGC
DILLQMHQSGDLIEELKKAGIISELLKAEEAKQQDDKAK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaaccgaatttgccagagtctccgccatccgagataccagattctcgccaccacagca
ccgcaatccctgctcacccgctttcttgcggcggatgcggccaccggcgcggcagtggac
aaggcgacaatggacaagctggtgcgcaccaacaaggtggtcgtcttcatgaagggcaac
ccacaggcgccacgctgcggcttcagcaatgcggtggtgcagattatgcggatgcacggt
gtccagtacgatgcccacgatgtgctgcaaaacgagtccctgcgacagggtgtcaaggac
tacaccgactggccgaccattccgcaggtgttcatcaatggcgaatttgtcggcggttgc
gacatcctgctgcagatgcaccagagcggcgatctcatcgaggagctcaagaaggcgggc
atcatttcggagctgctgaaagcggaggaggctaagcagcaggacgacaaggctaagtga

DBGET integrated database retrieval system