KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14619Help
Entry
Dmel_CG14619      CDS       T00030                                 

Gene name
Usp2
Definition
(RefSeq) ubiquitin specific protease 2, isoform F
  KO
K11833  ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG14619 (Usp2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG14619 (Usp2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG14619 (Usp2)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG14619 (Usp2)
Ubiquitin system [BR:dme04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmel_CG14619 (Usp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 33132
NCBI-ProteinID: NP_001245799
FlyBase: FBgn0031187
UniProt: Q8IQ27
LinkDB All DBs
Position
X
AA seq 938 aa AA seqDB search
MMLDIKKTRGFHKIPQASKLQSTTKTSSVVATSASSQNEVPSPGGSAGSKVGATNPVRAA
NQRFFLVSSYKDPTFLKAECDLAHAHVTTSKVKTTLQPHRRSRAGEDSRNNNYNTSRAPT
LINMRRPSLFNGNQQPTTTNSTTINNTTSRNTTSNTSNGVLKYSVRSTTATATSTSTRNY
GKLKPLNNNQTTAGVAMMNGHTNNNNNNTRNSSNINNGGNNNMQRQQQQHDDISFIDSDD
PPATGGPEAGISTTKTSICYFKPITPPLQLRHEQNQVQQQEEQPQPSSSKSASHRYPRPK
STIIASAHSNFAASFEKFSGGLYRQTNGETNIESKTSSNARRYGIDSLSIKASIEKFNNL
SGQKRQNPGSGSGIGPGSATASGLGGGRLSVASRSNHGSQAGGSSSNLQQRYSSDLDNIR
VAAGYSSSLTRAAYRTTATMNSVSTPVAVTSELGGPISGDGGETATAMGQPTSKVTVRGA
HSNRQPIECDSVVLTNKASKDATTAATPTVATATATHTPATSSVSTVTVTAAAPNSASDS
TLARSGTGSSSTARSVLPPMTPTSSRYWDRDSGTSRSSIGTSSALNSSSLKHNSDDGYKT
ASSSRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQQILHE
FAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVK
GETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWD
LSVPLPSSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHL
KRFSETRWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALC
KHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYERT
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagacattaagaagaccagaggattccacaagattccacaggcatccaaatta
cagtcaacaacgaaaacatcatcagtagtagccacatcagcatcaagtcaaaacgaagtg
ccatcaccaggaggatcggctggatcaaaagttggagctaccaatccagtgcgagcggcc
aaccagcgcttcttcctagtgtccagctacaaggaccccacatttctgaaggccgaatgc
gacctggcccatgcccatgtgacaaccagcaaagtgaaaaccacgttgcaaccgcaccgg
cggagtcgtgctggtgaggattcaaggaacaacaactacaacactagccgggcaccaacg
ctgattaatatgcgacgcccgtctctgttcaatggcaatcagcaaccaaccaccaccaac
agcaccaccatcaacaacaccaccagcaggaacaccaccagtaacaccagcaacggggtg
ctcaagtacagcgtgcgctccacgacggcaactgcaacttcaacgtctaccaggaactac
ggcaagctgaaaccgctcaataacaaccaaacgaccgctggagtagctatgatgaatgga
cacaccaataataataacaacaacaccagaaacagcagcaacatcaacaacggtggcaat
aacaacatgcaacgccaacaacagcagcacgatgacataagcttcatagacagcgatgat
ccgccggcaactggtggccctgaagccggaatatcgacaaccaagacgagcatttgttac
ttcaagcccatcaccccgccgctgcagctgcggcacgagcaaaatcaagttcagcaacag
gaagaacagccgcagcccagcagctccaagtctgccagccatcgctatccacgacccaag
tccactattatagcatcggcccactcgaattttgcggccagctttgagaagtttagtggt
ggcctctataggcagaccaatggcgagacgaacattgagagcaagaccagtagcaatgcc
agaagatacggcattgattcattgagtattaaggcctcgatagagaagttcaacaacctc
agtggccagaagagacaaaatccgggctctggatcaggtataggacctggcagtgctaca
gcgtccggtttaggaggaggacggctgtctgtggctagccgtagcaatcacggatcgcag
gcaggcggtagcagcagcaatctgcagcagcgctacagcagcgatctggacaacatacgc
gtggcggctgggtatagtagttccctgaccagagcagcctatcggactacagccacaatg
aatagtgttagcacaccggtagcggtaacctctgaactaggcggtcctattagtggcgat
ggaggagaaaccgccacggcaatgggtcagcccacaagcaaggtaacggtgaggggtgct
cacagcaaccggcagccaatcgaatgcgatagcgtggtcttgaccaacaaggcaagcaag
gatgcaacgacagcggcaacacctactgttgccactgccacagcaacacatacaccagcc
acgtcttccgtatccacagtcacagtcaccgccgcagctccaaactccgccagcgatagt
acgttggcgagaagtggcactgggagtagcagcactgcccggagcgtcctgccgcccatg
acgcctacgtcaagtcggtactgggatcgggacagcggcaccagccgcagcagcataggc
acctcctccgcactgaactcgtcatccctgaaacataactcggatgatggctacaagacc
gcctcctcttcgcgggatgagaagtccgaaggtctgtgcggtctgcgaaacattgggaac
acttgctttatgaactcggtcatccagtgcctgagtcacactcaagagctgacccgcttc
ttgcggtcgcaccacggctctcgttcgttatccaccaaggatcagcagatactccacgaa
tttgccaaactcattcaggagatgtggaccgctaacgtgcacacggtgacgcccatggag
ctaaagagggcgttctcgaccaaacatcgcatgtacagcgactacaaccaacaggatgcg
caggagttcctgcgttttttccttgactcgctgcattcggccctcaattcgggcgtcaag
ggtgagacgctcaacattgacgataatctcagtgacaataagaaggcggacttgacctgg
gagtggtatacgcggcacgagaactctctggtgcgcgacctgtttgtgggtcagctcaaa
agcacactgaagtgcaccacctgcggtaacaccagcgtcacctttgatccgttctgggat
ctgagtgtaccgttgccgtcttcgtcccgctgcaagctagaagcttgcctcgacctcttt
atccgcgaagaggtccttgacggcgacgaaatgcccacgtgcgccaagtgcaagacacgg
cgaaaatgcaccaagagcttcaccattcaacgtttccccaaatatcttgttatacaccta
aaacgcttttcggagacacgctggagcaagctgtccaacatcgttgaatttcccacatca
gacagcgagctgaacatgggctcctatggcgccaactccaactcgaatgtgcattactcg
ctctatgcgatatccaatcatatggggtcaacggctggtggtcattatgttgccctttgc
aagcatccagtttcccgcaagtggcacgaatttaatgataatatagtcagcgatgccttg
tccgaaaaccatctcgtttcatccagtgcctatattcttttctacgagcgtacgtaa

DBGET integrated database retrieval system