KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14934Help
Entry
Dmel_CG14934      CDS       T00030                                 

Gene name
Mal-B1
Definition
(RefSeq) maltase B1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00052  Galactose metabolism
dme00500  Starch and sucrose metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dmel_CG14934 (Mal-B1)
   00500 Starch and sucrose metabolism
    Dmel_CG14934 (Mal-B1)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dmel_CG14934 (Mal-B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 34597
NCBI-ProteinID: NP_609522
FlyBase: FBgn0032381
UniProt: Q9VKE6
LinkDB All DBs
Position
2L
AA seq 584 aa AA seqDB search
MVVVKIAFILSVGLVGILAHKHQSKELDAKYNWWQHEVFYQIYPRSFQDSNGDGIGDLQG
ITSRLQYFKDTGITSVWLSPIYESPMVDFGYDISNYTNIQPEYGTLEDFDALIAKANELG
VKVILDFVPNHSSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSGSA
WMWNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYIYEDA
QLRDEPPSGTTDDPNNEAYLSHIYTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEG
YASVSQLMEYYEDSNGVQGPQFPFNFDFITELNANSTAADFVFYISRWLIYMPHGHVANW
VMGNHDNPRVASRFGEKSVDAMNMLLMTLPGIGITYNGEELGMTDYRDISWSDTVDQPAC
EAGIDNYKTISRDPERTPMQWSSDVNAGFSSADRTWLPVNPNYKELNLRNQQQARRSHYK
IYQSLLKLRQLPVLKNGSFVPEVVNRRVFAFKRELKNEHTLLTIVNVSNRTELVDIADFI
EQPNRLSVLVAGVDSQHRVGDRLKAETIELAPNEGLVIQLNKRK
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagtgaaaatagctttcattttgagtgtgggcctagtaggcatattggcccat
aagcaccagtcaaaggagctggatgcgaaatataattggtggcagcacgaggtcttctat
cagatctatccgagatcctttcaggacagcaatggtgatggtattggtgatcttcaaggt
attacttctaggctacagtacttcaaggatacgggcatcacgtccgtatggttgagtccc
atttatgagtcaccaatggtagactttggatacgatatatctaactatacaaatatacag
ccggaatatggcacccttgaggactttgacgccttgatagccaaggccaatgaactgggc
gtgaaagttattttggactttgttcccaatcacagctcaaataagcatccctggttcata
aagtcagtagcccgagagccagggtacgaggatttctatgtgtgggaggatggtattctc
ctggagaacggaactcgtgtgccgcccaacaattggctgtcggtgttctccggatccgct
tggatgtggaacgatgagaggcagcagtactatctcaggcagttcacttatggacaaccc
gatttgaactaccgaaatcccgccgtgattaaggccatggatgatgtgatgctcttctgg
ctaaacaagggtattgccggcttccgcatcgatgccattatatatatttacgaggatgct
caactgagggatgagcctccgagtggcactaccgatgatccaaataatgaggcctacttg
agccacatctataccagaaatcagcctgaggattacggtctacttcagcattggcggcaa
cttctggataattatacagctaaccacgatgggccattgaggataatgatgaccgagggt
tatgcttcggtgtcgcaactaatggaatactatgaagattcgaatggtgtacagggcccc
cagtttcccttcaactttgacttcatcaccgaactgaatgccaattcgacagctgcggac
tttgtcttctatatctccaggtggctcatctatatgccacatggtcatgtggccaactgg
gtgatgggaaatcacgacaatcctcgagtggcatcacgattcggtgagaaatctgtggac
gccatgaatatgctgctgatgacattgccaggaattggtattacttataatggcgaggag
ttgggcatgactgactacagggacatcagctggagcgatacggtggatcagcccgcttgt
gaggctggaatcgacaactacaagacgatttctagagatcctgagcgaactcccatgcaa
tggagtagtgatgtgaatgcaggattctcctccgccgatcgcacttggttgcctgtcaat
ccgaattataaggaacttaatcttcggaatcagcagcaggcgaggcgaagtcattacaag
atctatcagtcccttctgaagctcagacaactgccagttctgaagaacggatcctttgtt
ccagaagtggttaatcgcagggtcttcgctttcaagcgagaactgaagaacgagcacact
ctgctgaccattgtgaacgtgagcaaccgcactgaactggttgacatcgcggactttata
gaacagcccaatcgattgagtgtccttgtggcgggagtggactcgcaacaccgggtgggg
gatcgacttaaggccgagacaattgaattggcgcccaacgagggattagttattcagctg
aataagcgaaagtaa

DBGET integrated database retrieval system