KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15170Help
Entry
Dmel_CG15170      CDS       T00030                                 

Gene name
CG15170
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF753 PriA_CRR
Motif
Other DBs
NCBI-GeneID: 35160
NCBI-ProteinID: NP_001286080
FlyBase: FBgn0032733
UniProt: X2J957
LinkDB All DBs
Position
2L
AA seq 560 aa AA seqDB search
MRGLQTNRHSSFHHLLLLFLVLLRYRCFGIVCYHCDSIALPECSQTLGEVGVLPYKECAT
ELTCAMSIVDSITYRGCGAETPIIGATYSKTCSTNLCNAGVYPPGRLKCHHCAGQECVAA
PASKPKPCRYHLEEDQCYTDVISSSDAYRGCTSEQNHTLSTSAQLCEINGCNEEQGAWTQ
VCATCDSAIGRGCKIDLFQVNTGRCNVSLYEECQQDVLLGEQEDKYCFSFRRLSRVVRGC
STKIPTDLEPYVEQLEKCNTSDHCNAGCITQQKCFTCNSVDQELCRTNITAIANSTCSSA
EASSCFSCEYSNWSIQRGCGAPPENPQITKCYECDEGAGCNSKDFTRCYQCSTDQAGAGC
ANWESPGEIYIEECDEPAAPCVVVSFNNATTARGCQKSDFSCASANVASCRLCEGSFCNK
GSFPEERLWCHQCRGVQDCEEISRGQTAMPCPARANEPEDQELACLEYFDINSKEIVRGC
RSNPELYYECLLRSNHFDSCRTCHSQACNNSPGRELRASYELEAKALSLLQGKSSAISIK
FSNAGYGVWLIFSVIYIVTC
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggactgcagacaaatcgccactcaagcttccaccacctgctcctccttttcctg
gtcctcctgagataccgttgttttggcattgtttgctaccactgcgattccattgccctg
ccggaatgttcccagaccctcggagaagtgggagttcttccctacaaggagtgcgctacc
gagctgacgtgtgccatgtccattgtggactccattacataccgcggctgcggagcagaa
acccccatcatcggagcgacttactcaaagacttgctcaacgaacctgtgcaatgcgggt
gtctatccgccgggacgacttaagtgccatcattgcgctggacaggaatgcgtggcagct
ccagcatccaaaccaaaaccctgtcgctatcatttggaagaggatcagtgctacacggat
gtcataagttcttcagatgcctacagaggttgtacctccgagcagaatcacacgctgtcc
acttccgcccaactgtgtgagatcaatggctgcaatgaggagcaaggagcttggacccaa
gtctgcgccacctgcgattcagcaatcggccggggttgcaagatagatctctttcaggtc
aacaccggcaggtgcaatgttagcttatacgaggaatgccagcaggatgttctgttgggt
gagcaagaggataagtactgcttcagctttcgcagactaagccgcgttgtcagaggatgt
tctactaaaattccaacagatttggagccgtatgtagagcaattagaaaagtgtaatacc
agtgaccactgcaacgcaggatgcattacgcagcagaagtgttttacatgcaactccgtg
gatcaggaactttgccggacaaatattacggctatagctaatagcacttgtagctccgct
gaggcctcttcctgtttctcctgtgagtactccaactggagtattcagcgaggctgtgga
gcaccgccggaaaatcctcaaatcaccaagtgctatgaatgcgatgaaggcgctgggtgt
aatagtaaggatttcacccggtgctaccaatgcagcacggatcaagcgggagcaggctgt
gcaaattgggaaagtcctggcgaaatctacattgaagaatgcgatgaaccggctgcacca
tgtgtggttgtttcctttaacaacgccaccactgcgagaggttgccaaaaatcggacttc
agctgtgcttccgcaaatgtggccagttgtcgactatgcgaaggaagtttctgcaacaaa
ggatcatttccggaggagcgcctctggtgtcatcagtgtaggggagtgcaggactgcgag
gagatctccaggggacaaacggctatgccttgtccggctcgagcaaatgagccggaggat
caagaattggcctgcttggagtactttgacatcaacagtaaagaaattgtaagaggatgt
cgttccaatcccgagctatactacgaatgtctcttaaggagtaaccacttcgacagttgt
cgcacttgtcacagtcaggcatgcaataatagtcctggccgggaattaagagccagctat
gagctggaggccaaggcattgtccttgttgcaaggcaagagttccgcaatatccatcaaa
ttttcgaatgcaggttacggagtttggttgatctttagcgttatctatattgtaacttgc
tga

DBGET integrated database retrieval system