KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15793
Entry
Dmel_CG15793      CDS       T00030                                 

Gene name
Dsor1
Definition
(RefSeq) downstream of raf1, isoform A
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04140  Autophagy - animal
dme04150  mTOR signaling pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG15793 (Dsor1)
   04068 FoxO signaling pathway
    Dmel_CG15793 (Dsor1)
   04150 mTOR signaling pathway
    Dmel_CG15793 (Dsor1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG15793 (Dsor1)
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG15793 (Dsor1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG15793 (Dsor1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG15793 (Dsor1)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dmel_CG15793 (Dsor1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 APH Kinase-like
Other DBs
NCBI-GeneID: 31872
NCBI-ProteinID: NP_511098
FlyBase: FBgn0010269
UniProt: Q24324
LinkDB
Position
X
AA seq 396 aa
MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MGDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
SGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAELEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaatctggtgctgccgccggtaaatacggaggcaactgttgcc
gccgccacagtggcgccgacgccgccattcaaaaccccctcgggcacagacacacacagt
ttgctggggaagcccaagacgagcatcgatgcgctgacagagacgctggagggtctggac
atgggcgacacggaacgcaagcggatcaagatgttcctcagccagaaggagaagatcggc
gagctgtccgacgaggatctggagaagctgggcgagctcggatcgggcaatggcggcgtg
gtgatgaaggtccggcacacgcacacacacctgatcatggccaggaaactgatccatctg
gaggtgaagccggcgatcaagaaacagatcctgcgcgaactgaaagtcctgcacgaatgt
aatttcccgcacattgtcggtttctacggcgccttctacagcgacggcgagatcagtatc
tgcatggagtatatggacggtggatcacttgacctgatcctcaagcgggccggtcgaata
ccagagtccattctcggcaggatcacgctggcggtgctcaagggcttgagctatctgcgc
gacaatcacgccatcatccaccgtgacgtgaagccgagcaatatcctcgtcaatagcagc
ggcgagatcaagatctgtgatttcggcgtctccggtcaactgatcgactcgatggccaac
tcctttgtgggcacccgtagctatatgtcgccggagcgattgcagggcacccactactcc
gtgcagtcggacatctggtcgttgggtctgtcgctggtggagatggccatcggcatgtac
cccatcccgccgccaaacaccgccaccctggagtcgatattcgccgacaatgcggaggag
agcggccagccgacggacgagcccagggcaatggccatcttcgagctgctggattatatt
gtaaacgaaccgccgcccaagctagagcacaagatcttctccaccgagttcaaggacttc
gtggacatctgcctgaagaaacagcccgacgagcgggcagatctcaagaccctgctgagt
catccgtggatacgcaaggcggaattggaggaggtggatatatccggctgggtgtgcaag
acaatggacctgccgccatcgacgccaaagcgtaatacgtcgcccaactag

DBGET integrated database retrieval system