KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1689
Entry
Dmel_CG1689       CDS       T00030                                 

Gene name
lz
Definition
(RefSeq) lozenge, isoform A
  KO
K20214  RUNX transcription factor Lozenge
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG1689 (lz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG1689 (lz)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    Dmel_CG1689 (lz)
SSDB
Motif
Pfam: Runt
Other DBs
NCBI-GeneID: 31883
NCBI-ProteinID: NP_511099
FlyBase: FBgn0002576
UniProt: Q9W349
LinkDB
Position
X
AA seq 826 aa
MHLHLLAAEKTPPSPSPNPTPTPSASPSGHTGAAGESQLDLASQTESQLQLGLPLASGYG
LGLGLGLGLGLGLGQELVADHSTTVAPVSVAGPGRLGRSINGSGGSHHHHHLHHHYSPYH
HAHPYHPPHPHAPHHHHHHHPPYPYPPAGPHPPAMVTSSSTSPTGNGWSSSTGDFKGITA
VATATGGGVGGATQGATASTGATAAEVLAVSSSASVGSSSPTGGASNGTAHSGHSGHTGG
HSSSTASNNNNNGASNSNSNNNNAVHQDLLWMERLVQKRQQEHPGELVRTSNPYFLCSAL
PAHWRSNKTLPMAFKVVALAEVGDGTYVTIRAGNDENCCAELRNFTTQMKNDVAKFNDLR
FVGRSGRGKSFTLTITVATSPPQVATYAKAIKVTVDGPREPRSKTSPTGGPHYRALGLGQ
RPYIDGFPSTKALHELESLRRSAKVAAVTTAAAAAATAASAANAVAAAAAAVAVTPTGGG
GGVAAGGVAGGAGAGLVQQLSSNYSSPNSTINSDCQVYKPNAPHIQAAEMMGAGEWTNGS
SSSAAAYYHSHAHHPHAHHAHAHLQHQMALPPPPPPPAAAPVSVGVGGNGATMGMGMGVG
VGMGMNHYGGGYDSANSLEAGQYAAHLPAVLPEMHGHGFATDPYQTAGYGGGNTGGGSAS
KSELDYGGSYNQAWSNGYQNYQYGSCLATAQYGPQAAPPPQPPPPPPVVLCPQLYSTVNQ
NQIHLHLHSSEKLEQYLGTATSADHLTIGSLTGSSRSSIEIGQDQYHQQVHHAQQQQQQQ
QQQQQVHHPQQQQVESAGEVGGSGAGGVESAREEDVGDLSQVWRPY
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgcatttgcatctcctggcggcagagaagacgcctccatctccatctccaaatccaact
ccaactccatcagcatctccatctgggcatacgggcgctgctggggagtcgcaattggac
ttggcatcgcaaacggaatcgcaattgcagctgggcttgccattggcttccggatacgga
ctcggactcggattgggactgggcttgggattgggactgggccaggaattggtggcggac
cacagcaccactgtggcgcccgtcagcgttgccggtcccggccgcctgggtcgcagcatc
aacggcagcggcggcagccaccaccatcaccacctgcaccaccactactcaccgtaccac
cacgcccacccctaccacccaccgcatccgcacgcgccccaccaccaccaccaccaccac
ccaccgtatccgtatccgccggcaggaccacatccgccggccatggtcacatcgtcatcc
acatcgccgacgggcaacggctggagcagctccaccggcgacttcaagggcatcacagcg
gtggcgacggccactggcggcggcgtaggtggtgccacccagggcgccactgcatccacg
ggcgccacagccgctgaggttttggccgtttcgagtagtgccagtgttggcagcagctcg
cccacaggtggcgccagcaatggtacagcccatagtgggcatagtggacacaccggcggt
cacagcagtagtaccgccagcaacaacaacaacaacggtgccagcaatagcaatagcaac
aataacaacgccgttcaccaggatctattgtggatggagcgattggtacagaagcgacaa
caggaacatcccggcgaattggtgcgcacgagcaatccgtacttcctgtgctccgccctg
cccgcccattggcgctccaacaagacgctgccgatggccttcaaggtcgtcgctctggcg
gaagtgggcgatggcacctatgtcaccatccgggcgggaaacgatgagaattgctgcgcg
gagctgcgcaacttcaccacccagatgaagaacgacgtggccaagttcaatgatctgcgt
ttcgtgggacgcagcggaagagggaagagcttcacgctgaccatcacggtggccacgagt
ccgccacaggtggcaacctacgccaaagccatcaaggtgaccgtcgatggaccccgcgag
ccccgctccaagacaagtccgaccggtggtccgcactaccgagctctgggtctgggccag
cgtccctacatcgatggcttcccctcgacgaaggcgctccacgagctggagtcgctccgg
cggtccgccaaggtggcagcggtgacgacggcagcggcggcggcggccacagcggcatcc
gcggccaatgcggtggcggcggccgcagccgctgtggcggtaactccaacggggggcggc
ggcggcgttgcagctgggggcgtggctggcggagcaggcgctggactcgtgcagcaattg
agcagcaattactcatcgccgaatagtacaatcaactcggactgccaggtctacaagccg
aatgcgccgcacatacaagcagccgaaatgatgggcgccggcgaatggacaaatggatcc
tcgagttcggcggctgcctactaccacagccacgcccatcatccgcacgcccaccacgcc
cacgcgcacctgcaacaccagatggccttgccaccgccgccgccgccacccgctgcggca
cccgtttcggtgggcgtgggcggcaatggagccaccatgggcatgggcatgggagtggga
gtgggcatgggcatgaatcactacggcggtggctacgactcggccaactcgctggaggcg
ggccagtatgccgcccacctgccggcggtgctgcccgagatgcatggccatggattcgcc
accgatccctaccagacggccggctatggcggtggcaatacgggcggaggcagtgcatcc
aaatcggaactggactatggcggcagctacaatcaggcgtggtcgaatggctatcagaac
tatcagtatggcagttgtttggccaccgcccagtacggtcctcaggcggcgccgccacca
cagccaccgcctccgccgccggtggtgctgtgcccgcagctgtactccacggtcaatcag
aatcaaatccacctgcatctgcacagcagcgagaagctggagcagtatctgggcacggcc
actagtgcggaccatctcaccattggatccctgacgggcagcagtcgttccagcattgaa
attggccaggatcagtaccaccagcaggtgcaccacgcacagcagcagcaacagcagcag
cagcaacaacaacaggtgcaccacccacagcagcagcaggtggaatccgctggcgaagtg
ggtggcagtggtgccggcggagtggaatccgccagggaggaggacgtgggcgatctctcg
caggtgtggcgaccctattga

DBGET integrated database retrieval system