KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16928Help
Entry
Dmel_CG16928      CDS       T00030                                 

Gene name
mre11
Definition
(RefSeq) meiotic recombination 11
  KO
K10865  double-strand break repair protein MRE11
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03440  Homologous recombination
dme03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Dmel_CG16928 (mre11)
   03450 Non-homologous end-joining
    Dmel_CG16928 (mre11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dme03032]
    Dmel_CG16928 (mre11)
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG16928 (mre11)
DNA replication proteins [BR:dme03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     Dmel_CG16928 (mre11)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     Dmel_CG16928 (mre11)
    BRCA1-C complex
     Dmel_CG16928 (mre11)
   NHEJ (non-homologous end-joining)
    MRX complex
     Dmel_CG16928 (mre11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 34565
NCBI-ProteinID: NP_523547
FlyBase: FBgn0020270
UniProt: Q9XYZ4
LinkDB All DBs
Position
2L
AA seq 620 aa AA seqDB search
MNGTTTAEQDADNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLG
GDLFHDAVPSQNALHKCIELLRRYTFGDRPVSLEILSDQGQCFHNAVNQSVNYEDPNLNI
AIPVFSIHGNHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDLTQVEISPVLMRKGESQLAL
YGLSHIHDGRLARLIKDFKVKFNCPENVANGEDGNESKEEEDWFHLLVVHQNRADRGPKN
YLPEDLLPSFLHLVIWGHEHDCRIEPEENAKKRFYVSQPGSSVPTSLSEGEAKKKHVGLL
EIYKGKFKLKPLPLETVRPFVYESVVLADHADELGLVEGDASTKVFKFAQERVEAMIERA
VAQHTGHPKQPTLPLIRLRLLYTDESCMFNAIRFGEMLSTRVANVQDVVQFSKVVKRTKT
EAVNLDKEALRRALEADNATRVEELVDRYFEEAKSNKPLKLFHSKALAEMTYRLLEQRDA
DAAENIVKFYKEKAVDHLMEAMPNDENIDEELERFRALHKHGDLLKMLDTQGLKVKKEEK
SMSVLGSEVNVSTAPATGRGAARGRGTARTRAGATAATRGKGQLDVTVSSTRTSGRQQTL
LSSLMGSRNTASYVISDDSD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcaccacgacagcagagcaggatgctgacaacgtgattcgcatcctggtggct
accgacaaccacctgggctatggcgaaaaagacgcggtgcgcggcgaggacagtttcacg
gccttcgaggagatcctggaactggcggtgtccgaggatgtggacatgattctgctggga
ggtgacctcttccacgacgccgtgcccagccagaatgcgttgcacaaatgcattgagctc
ctgcggcgctacacattcggtgatcgtcctgtttccctggagattctcagcgaccagggg
caatgcttccacaatgccgttaaccagtcggtgaattacgaggatcccaatctgaacatt
gccattccagtattctctattcatggcaatcacgacgatcccagtggcttcggtcgttta
agttctctggatttgctgagcacctcgggactggttaactattttggtcggtggaccgat
ctaacccaggtggagatcagccccgtcctgatgcgcaagggagagagccaattggctttg
tacggacttagccacatccacgacggccgactggcaaggcttatcaaggattttaaggtg
aagtttaactgtcccgagaacgttgctaatggcgaagacggtaatgagtccaaagaggag
gaggattggttccatctgttagtggtacatcagaaccgcgccgatcggggaccaaagaac
tatctacctgaggacctgttgccatcgtttttgcatctggtgatttggggtcacgaacac
gattgccgcatcgagccagaggagaatgccaaaaagcgcttctatgtctctcagccgggc
tcttcggtgcccacctccttgtccgagggtgaggccaagaaaaagcacgtcggcctgctc
gagatctacaagggaaaattcaagcttaagccgcttccgctggagactgtgcggcctttc
gtctatgaatccgtcgtactggccgaccatgccgacgaattaggccttgtcgaaggtgat
gcctctaccaaggtttttaaattcgcccaggaacgagtggaggcaatgatcgagcgggcg
gtagcccaacacaccggtcatcctaagcagccaacgctaccgctcattcggttgcgtctc
ctctacacagatgagtcctgcatgtttaatgcgattcggtttggagagatgttgagcact
cgggtggccaacgttcaggatgtggtgcagttcagtaaggtggttaagcgtaccaaaacg
gaggctgtcaatctggacaaagaggcattgcgacgtgcactggaagcggataatgccact
cgcgtggaggagttagtggatcgatatttcgaagaggccaagtcgaataagcctctcaag
ttattccactcaaaggctcttgcagagatgacctatcgactgttggagcaaagggatgcc
gatgcagctgaaaatattgtcaagttctacaaggaaaaggcagttgatcacttgatggaa
gcaatgcccaacgacgagaacatcgatgaggagcttgaaagatttagggcgcttcacaag
catggggatctactgaaaatgcttgacacacagggcttgaaggtgaagaaagaagaaaag
tccatgtctgtgttgggtagcgaagtgaacgtctccactgcccccgcgacgggacgagga
gctgctaggggtcgtggaactgcacgaactcgtgcaggtgccacagctgccacacgtgga
aagggccagctagatgtgacagtcagtagtacgcgaacttccggcaggcaacaaacgctc
cttagtagccttatgggctctcgtaatactgccagctatgttatatcggatgattccgat
tga

DBGET integrated database retrieval system