KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16932Help
Entry
Dmel_CG16932      CDS       T00030                                 

Gene name
Eps-15
Definition
(RefSeq) epidermal growth factor receptor pathway substrate clone 15, isoform D
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmel_CG16932 (Eps-15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG16932 (Eps-15)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dmel_CG16932 (Eps-15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 ATG16 IFT57 Cast CCDC158 Spc7 RasGAP_C MPS2 UPF0242 DUF603 FPP Golgin_A5 Fez1 APG6_N DUF4140 Tropomyosin Mod_r KASH_CCD DUF641 ERM DUF4407 V_ATPase_I Spectrin
Motif
Other DBs
NCBI-GeneID: 37961
NCBI-ProteinID: NP_001246502
FlyBase: FBgn0035060
UniProt: E3CTP7
LinkDB All DBs
Position
2R
AA seq 792 aa AA seqDB search
MNVDFARVCGKHIGVYEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPS
GKGFLDKPGFFVALKLVSLSQAGQVASMANIYLDIANPPKLGELPKTMPSRIQTVPVASG
GVANGDWSIGVIDRLKYEQLFESLHPSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQD
KDGNLDMHEFVVAMHLVYQTLQKRTIPSVLPPELRKPGGAGPPPKPAMPPPPAGAAMPRA
PSGEGFGDGGFVANFPKDIAPPAAIPPLPVAVPPMTRIPPVGAVSSQPLIQTDPLIPIGA
PVMANADWVVTPADLKRFEEIFRQSDLDKDGLVSGLEVKDIFIKSGIPQRSLADIWALCD
TNQSGKLTVEQFALAMWFVERKQRGVDPPHVLNANMVPPSMRATVAGVDLQPQEVKPTYS
NPELEMISKEIEELARERRVLETEIAQKEADVRIKNGEVRSLQSELDTLTATLKQLENQR
GEAQKRLDDLQAQVTKIRDQCHMQEVTINEQEGELNAKRSELQKLKDEEASLQKEYDSNN
RELSKLTNHLQATQLQISSVRSMVTQLLETQRQMTDALLICRAAMENQNAELVSEYQLKI
EPDFDEARKTLTKEVQLPKDDPFEENNSGAANQATNGFGSDPFSGQPVNKPAISTGFDDS
FNMSSGFDSGFDAFGQSGAGSAFGQTQRDPFGSDAFAANKSNAITPEPGKDDFGSDPFAA
LHAPTGQGQVLSPNAQKSGPPPRPESPSPALPPKKSKVPPPRPAPPRAAQPTGGFGSGGG
GGFADFDDFDNK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggactttgcgagggtgtgcgggaagcacataggcgtctacgaggcctactac
aaactgattgaccccaaaggcacaggggcaatcgaggccatgactgcggccaagtttctc
aagaagtcgggccttagcgacgttgtgctaagcaggatctgggacctgtctgatccgagc
ggcaagggctttctggacaagccgggcttttttgtagcccttaagctggtgtccctgtcg
caggcgggacaggtggccagcatggccaacatctacctggacattgccaacccgcccaag
ttgggtgaactaccaaaaacgatgccgtcgcgtattcagactgttcccgttgctagcggc
ggagtggcaaacggagactggtccatcggggtgatcgatcggctcaagtacgagcagctc
ttcgagtccctgcatcccagtaatggaatgctgccgggcaacaaggttaaaggcgtgctc
atggactccaagctgcccatgagcatactgggaactatatgggacctggccgaccaggac
aaggacggcaacctggatatgcacgaattcgtggttgccatgcacctggtctaccagacg
ctgcagaagcgcaccattcctagcgttctgccgcccgagctgcgaaagcccggaggagca
ggtccgccaccgaagccagccatgccaccaccgccagcgggtgctgctatgccacgtgct
cccagtggggaaggatttggggacggcggatttgtagcaaattttcccaaggatatagcc
ccgccggcggctattccgccgctcccggtggctgtgccccccatgacgcgcattcccccg
gtgggagcagtcagctctcagccgctgattcagacggatccattgataccgattggggct
ccggtgatggcgaatgccgactgggttgtcaccccagcggacctaaagcggttcgaggag
atcttccggcaatcggatctggataaggacggcctggtctccggccttgaggtgaaggat
attttcatcaagtcgggtattccgcagcgaagcctagcagacatctgggctctttgtgac
accaatcagtccggtaagctgactgtggagcagtttgcactggccatgtggttcgtggag
cgaaagcagcgcggtgtggacccgccacatgtcctcaacgccaatatggtgccgccctca
atgcgcgccactgtggctggagtcgatctgcagccgcaggaggtcaagcccacttactca
aacccggagctggaaatgatctccaaggagattgaggagttggcccgtgagcggcgggtt
ctggagacggagattgcccaaaaggaagcggatgtgcgcatcaaaaacggcgaagtgcgc
agtttgcagagtgaactggatactcttaccgccacactgaagcagctggagaaccagcga
ggagaggcccagaagcgactggatgacctgcaggctcaagtgaccaagattcgcgaccag
tgccacatgcaggaggtgaccatcaacgagcaggagggcgaattaaacgcaaaacgctcg
gagctgcagaagctcaaggacgaagaagcttcgttgcaaaaggagtacgacagcaacaat
cgggagttatccaagctaaccaaccacctgcaggcaacccaactgcaaatcagctcggtc
cgatcaatggtcacacagctgctggagacgcagcgacagatgaccgacgctttgctcatt
tgtcgggctgccatggagaaccaaaacgcggaactcgtatccgaataccagttgaagata
gagccggactttgatgaggcgcgcaagaccctgacaaaggaagtgcaactgcccaaggat
gatccctttgaggagaacaacagcggcgccgccaatcaagctaccaacggctttggcagc
gatcccttctccggtcagccggtcaacaagccggctatttctacaggctttgatgacagc
ttcaacatgagctcaggcttcgatagtggcttcgatgcctttggtcagagcggagcgggc
tcagcctttggtcagacccagcgggatccattcggctcggatgcctttgcagccaacaag
agcaacgccattactcctgagcccggcaaggacgacttcggcagtgatccgtttgctgcc
ttgcatgctccaaccggccagggtcaggtgctcagtcccaacgcccagaagtccggaccg
ccgcccagaccggagtctcctagtccagcattgccgccaaagaagtccaaggtgccgccc
ccacgaccagcgccaccacgagcagcccagcccacgggtggtttcggaagcggcggcgga
ggaggatttgccgactttgacgacttcgacaataagtga

DBGET integrated database retrieval system