KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1716Help
Entry
Dmel_CG1716       CDS       T00030                                 

Gene name
Set2
Definition
(RefSeq) SET domain containing 2, isoform B
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG1716 (Set2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG1716 (Set2)
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dmel_CG1716 (Set2)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dmel_CG1716 (Set2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 32301
NCBI-ProteinID: NP_001162740
FlyBase: FBgn0030486
UniProt: Q9VYD1 E1JJN9
LinkDB All DBs
Position
X
AA seq 2313 aa AA seqDB search
MEESGPPSNPSPVASRGRGRGRPPKVALSALGNTPPHINPSLKHADAEASPTAPEDQDSG
QSECRRSSRKKIIKFDVRDLLNKNRKAHKIQIEARIDSNPSTGHSQSGTTAASTSMSTAT
ASAASASSAATVSRLFSMFEMSHQSLPPPPPPPTALEIFAKPRPTQSLIVAQVTSEPSAV
GGAHPVQTMAGLPPVTPRKRGRPRKSQLADAAIIPTVIVPSCSDSDTNSTSTTTSNMSSD
SGELPGFPIQKPKSKLRVSLKRLKLGGRLESSDSGNSPSSSSPEVEPPALQDENAMDERP
KQEQNLSRMVDAEENSDSDSQIIFIEIETESPKGEEEQEEGRPVEVEPQDLIDIDMELAK
QEPTPDPEEDLDEIMVEVLSGPPSLWSADDEAEEEEDATVQRATPPGKEPAADSCSSAPR
RSRRSAPLSGSSRQGKTLEETFAEIAAESSKQILEAEESQDQEEQHILIDLIEDTLKSDN
IAASLNKDIFEPKVETKATCGEVVPRPEMVTEDVYITEGIAATLEKSAVVTKPTTEMIAE
TKLSDEVVIEPPLKDESDPKQTEVELPESKPAVNIPKSERILSAEVETTSSPLVPPECCT
LESVSGPVLLETSLSTEEKSNENVETTPLKTEAAKEDSPPAAPEEEASNSSEEPNFLLED
YESNQEQVAEDEMMKCNNQKGQKQTPLPEMKEPEKPVAETVSKKEKAMENPARSSPAIVD
KKVRAGEMEKKVVKSTKGTVPEKKMDSKKSCAAVTPAKQKESGKSAKEAILKKETEKEKS
SAKLDSSSPNTLDKKGKDTAQWSPQLQTLPKSSTKPPQESAPSVISKTTSNQPAPKEEQH
AAKKGLSDNSPPSVLKAKEKAVSGFVECDAMFKAMDLANAQLRLDEKNKKKLKKVPTKVE
APPKVEPPTAVPVPGQKKSLSGKTSLRRNTVYEDSPNLERNSSPSSDSAQANTSAGKLKP
SKVKKKINPRRSTICEAAKDLRSSSSSSTPTREVAASSPVSTSSDSSSKRNGSKRTTSDL
DGGSKLDQRRYTICEDRQPETAIPVPLTKRRFSMHPKASANPLHDTLLQTAGKKRGRKEG
KESLSRQNSLDSSSSASQGAPKKKALKSAEILSAALLETESSESTSSGSKMSRWDVQTSP
ELEAANPFGDIAKFIEDGVNLLKRDKVDEDQRKEGQDEVKREADPEEDEFAQRVANMETP
ATTPTPSPTQSNPEDSASTTTVLKELETGGGVRRSHRIKQKPQGPRASQGRGVASVALAP
ISMDEQLAELANIEAINEQFLRSEGLNTFQLLKENFYRCARQVSQENAEMQCDCFLTGDE
EAQGHLSCGAGCINRMLMIECGPLCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAEL
LIPPGEFIMEYVGEVIDSEEFERRQHLYSKDRNRHYYFMALRGEAVIDATSKGNISRYIN
HSCDPNAETQKWTVNGELRIGFFSVKPIQPGEEITFDYQYLRYGRDAQRCYCEAANCRGW
IGGEPDSDEGEQLDEESDSDAEMDEEELEAEPEEGQPRKSAKAKAKSKLKAKLPLATGRK
RKEQTKPKDREYKAGRWLKPSATGSSSSAEKPPKKPKVNKFQAMLEDPDVVEELSLLRRG
GLKNQQDTLRFSRCLVRAKLLKTRLALLRVLTHGELPCRRLFLDYHGLRLLHAWISENGN
DDQLREALLDTLESLPIPNRTMLSDSRVYQSVQLWSNSLEQQLAVVPQEKQAALHKRMVA
LLQKWQALPEIFRIPKRERIEQMKEHEREADRQQKHVHASTALEDQRERESSNDRFRQDR
FRRDTTSSRIGKPIRMSGNNTICTITTQQKGSNGAPDGMTRNDNRRRSDIGPPSEQRRTL
SKELRRSLFERKVALDEAERRVCTEDRLEHELRCEFFGADINTDPKQLPFYQKTDTNEWF
NSDDVPVPAPPRTELLTKALLSPDIDVGQGATDVEYKLPPGVDPLPPAWNWQVTSDGDIY
YYNLRERISQWEPPSPEQRLQTLLEENTTQQPLHELQIDPAVLENELIQVDTDYVGSLSA
KSLAQYIEAKVRERRDLRRSKLVSIRLISPRRDEDRLYNQLESRKYKENKEKIRRRKELY
RRRKIEVLPDAVDEIPVPGKALPIQPYLFSSDEEETKVAAIEQPAAEEEQDSLNMAPSTS
HAAMAALGKAVAQPTGLGTVGKRKLPMPPSVTVKKHRQEQRSKKVKSSQSPLTATSAREA
HEKFRFEISGHVANFLRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNP
LSCTESVKHKSYDFINQYMRQKGPVYKKPAEND
NT seq 6942 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtcgggtccgccaagcaatccgtctccggttgcgtcacgtggccgcggacgt
ggtcgcccgccgaaagtggcgctttccgcgttgggaaatacgcccccgcacattaatcca
tcgttaaaacacgccgatgcagaggcatcgcccacggcgccggaggatcaggattccgga
cagagcgagtgccggcgcagttcgcgcaagaaaatcatcaagttcgatgtccgggatttg
ctaaacaagaaccgcaaggcgcacaaaatccagatcgaggcacggatcgactcgaatccc
agtaccggccactcccagtcaggcacaactgcagcatccacatccatgtcaacagcaaca
gcatcagccgcatctgcatcctcagccgcgaccgtgagccgtttgttttccatgttcgag
atgagccaccaatcattgccgccaccaccaccgccgccaaccgccctcgagatcttcgcc
aagccaagacccacacagagtctgattgtggcccaggttaccagtgaaccatcggctgtt
ggtggcgcacatcctgtgcagacgatggccggcctgccgccggtgacacctcgcaagcgg
ggtcgtccccgtaagagtcaactagcggatgcggccattattccaactgtcattgtgccc
agctgctccgattccgatacgaactccaccagcacgaccacttccaacatgagcagtgac
agcggcgagcttcctggctttcccatacagaaacccaagtccaagttgcgggtctcactc
aaacgcttgaaactgggcggccggctggagtcctccgattcggggaactcgccatcgtcc
tcttcgccggaggttgagccaccagcactccaggatgagaacgccatggacgaacggcca
aagcaggagcagaacctgagccgaatggtcgatgccgaggaaaactccgattccgactca
cagatcatattcattgagatcgaaacggagagccccaagggagaggaggagcaggaagag
ggacggccagtcgaggtggaaccacaagatttgatcgacatcgacatggagctggccaag
caggaaccaactcccgacccggaagaagatctagatgagattatggtggaggtgctcagt
gggccacccagtctctggtcagcggacgatgaagccgaggaagaggaggatgcgacagtt
cagagagccactccaccgggaaaggagcctgcagcggattcctgctcttcagctccacgg
cgcagcaggcggtcagcgccgttgagtggcagcagtcgccaggggaagactctcgaggag
accttcgccgagatagccgctgagagcagcaagcagatcctggaggcggaggaatcacag
gatcaggaggagcagcacatactgatagatctcatcgaagacacgctaaagtcagacaat
attgctgcaagcttgaacaaagacattttcgagccaaaagtggaaactaaagctacgtgt
ggcgaagtggtcccacggccagaaatggtcaccgaagatgtttatattacagaaggaatt
gctgcaactcttgaaaaatcagccgtagtaacaaaaccaactacagaaatgattgcagaa
acaaaactatccgatgaagtcgtaatagagccgccactaaaagatgaatccgatccaaag
caaacggaggtagaactgcccgaatcgaagccagcagtaaacattccaaagtccgagcga
attttatccgccgaagtggaaacgacgtcgtctccacttgtgccgccagaatgttgcacc
ctggaaagtgtaagtggaccggtactattagaaacatcattgtcaacggaagaaaagtcg
aacgaaaatgtagaaaccactccattgaagactgaggcagcgaaagaggatagtccaccg
gccgctccggaagaagaggcatcgaatagttcggaagaacctaattttttgctagaagat
tacgaaagcaaccaggaacaagtagctgaagacgaaatgatgaagtgcaacaatcaaaag
gggcaaaagcaaacaccgttgccagagatgaaggagcccgagaaacccgtcgccgaaact
gtgtccaaaaaggagaaggcaatggaaaatccggccaggtcttcgccagcaattgtggat
aaaaaagtacgcgcaggtgaaatggaaaagaaggtcgtaaaatccacgaaagggactgtt
ccagaaaagaaaatggattcgaagaaatcttgtgcagccgtaactcctgctaagcaaaaa
gagagtggaaaatctgcaaaggaagctattttgaagaaggaaactgaaaaggagaagtct
tcagcaaaattagattcgtcatcacctaatacactggataaaaagggaaaagatactgcc
caatggtcacctcagctccaaactttgccaaagagcagtactaagccaccacaagaatct
gcaccgtcagtgatctcgaaaaccacatcgaatcaacccgcacccaaagaggaacaacat
gcagcaaagaaaggtctttccgacaattcgccaccatcggttctcaaggccaaagagaaa
gctgtgtccggtttcgttgagtgcgatgccatgtttaaggcaatggatttggcaaacgcc
cagttgcgtctcgatgagaagaacaagaaaaagctgaagaaggtgccgaccaaggtagag
gcaccgccaaaggtagaaccacccaccgccgtgcctgttcctgggcaaaaaaagtcgctg
tctggtaagaccagcttgcgcaggaacaccgtctacgaagactcacccaatttggaacgg
aacagttctcccagctccgattccgctcaagcaaacacttcggctggcaagttgaagcca
tcgaaggtcaaaaagaagattaatccgcgacgcagcacgatatgtgaggcagccaaggat
ctcagatcgagctcgagtagcagcacacccactagggaggtggccgccagctcgccagtt
tccacctcatcggattcctcatcgaagcgaaacggatccaagagaaccacgtctgatctg
gacggtggctccaagttggatcaacgacggtacaccatctgcgaggatcgtcaacccgag
accgccataccagtaccgctgaccaagcgccgcttctcgatgcatcccaaggcatctgcg
aatccgctgcacgatacccttcttcaaacggcgggcaagaagcggggccgaaaggaaggc
aaagagtcactgagccgccagaattcgctagactccagttcgagtgcctcccaaggagca
ccgaaaaagaaggccctaaagtctgcagaaattctaagtgcggcgctcttggaaactgag
tcgtccgagtccacttcatcgggaagcaaaatgagccgctgggatgtgcaaacctcgccg
gaactggaggctgccaatccgttcggcgacattgccaagtttatcgaggacggcgtgaat
cttctcaagcgcgacaaggtggatgaagatcaacggaaggaggggcaggatgaagtgaag
cgagaagccgatcccgaggaggatgaattcgcgcaacgggtggctaatatggagaccccg
gccacaacgcctaccccatcgcccacgcaatcgaatccggaggactcagcatccaccacg
actgttctcaaggagcttgagaccggcggaggcgtgcgccgctcccatcggatcaagcag
aagccgcagggaccacgcgctagccagggcagaggtgtggccagcgttgcgctagcacca
atcagcatggacgagcagctggccgagctggccaacatcgaggccatcaacgagcagttt
ctgcgcagcgagggcctgaacactttccagttgctaaaggaaaacttctatcgttgtgcc
aggcaggtgagccaagagaatgccgaaatgcaatgcgattgctttctcactggcgacgag
gaggcgcagggtcatctaagctgcggcgccggctgcatcaatcgaatgctgatgatcgag
tgcggaccactgtgctcaaatggcgcgcggtgcaccaacaagcgcttccagcagcaccag
tgctggccatgtcgcgtttttcgcacggagaagaagggatgcggcatcacggcggaactg
ctaataccgccgggtgaattcatcatggagtatgtgggcgaggtgatcgatagcgaggag
ttcgagcgccgacagcatctgtactcgaaggatcgcaatcgtcactactatttcatggcg
ctgcgaggagaagccgtcatcgacgccacctccaagggtaatatctcgcggtacatcaac
cacagttgcgatccgaatgccgagacgcagaaatggacggtcaacggagagctacgcatt
ggtttcttcagcgtgaagcctattcaacccggcgaggagattaccttcgattaccagtac
ctgaggtatggccgagatgcgcagcgttgctactgcgaggcagccaactgcaggggttgg
attggaggtgaaccggactcggatgagggcgagcaactggatgaggaaagcgacagcgat
gctgagatggacgaggaggagctggaagccgagccggaggagggccagccgcgcaagtca
gccaaggcaaaggcgaagtcgaagctcaaggcgaagctaccactggccaccggtcgcaag
cgcaaggagcagaccaagcccaaggatcgcgaatacaaagccggccgctggctgaagccc
tctgctaccgggtcatcatcatcggccgaaaagcctccaaagaaaccaaaggtcaacaaa
ttccaggcaatgctcgaggatcccgatgtggtggaggagctctcgctgcttaggcgcggc
gggcttaagaaccaacaggacacgctgcgcttctcgcgttgcttggttcgtgccaagttg
ctcaagactcggctggcacttttgcgtgtgcttacccatggagagctaccatgtcgccgg
cttttcctggactatcacggcttgagattgctacatgcctggataagcgagaatggcaat
gatgaccagctgagagaagcccttctggacaccctcgaatccctgcccatcccgaatcgc
accatgctaagtgatagtcgcgtataccagagtgtccaactgtggagcaacagtctggag
cagcagttagctgtggtgccgcaggagaagcaggcggctcttcacaaacggatggtagcc
ttgctccaaaaatggcaagctctgccggagatcttccgcatccctaagcgcgaacgaatc
gagcagatgaaggagcacgaacgtgaggcggatcgccaacaaaagcatgtccatgccagc
accgctctggaggatcagcgcgagcgggagagcagcaacgatcgcttcaggcaggaccgt
ttccgacgggacacaacgagcagtcgaataggcaaacccatccgcatgagcggaaacaat
accatatgcacgataaccactcagcagaagggcagcaacggagccccagacggaatgacc
agaaacgataatcggcgcaggtccgacattggaccgccgtccgagcaaaggcgtacgctg
tccaaggagctccggcgcagtctgtttgagaggaaggtggctctggatgaggctgagagg
cgcgtgtgcaccgaggaccggctcgagcacgagctgcgctgcgagttctttggcgctgat
atcaacacggatcccaagcagttgcccttctatcaaaaaacggatactaacgagtggttc
aacagcgacgacgtgcccgtaccggcaccgccgcgcacagaactgttgacgaaggcgctg
ctatcacccgatatcgatgttggccagggtgcaactgacgtcgagtataaactgccgcct
ggagtggatcccctgccgcccgcttggaactggcaggtgacgagcgacggtgacatctac
tactacaatctgcgagagcgcatatcgcaatgggagccacccagtccggaacagcgcctt
cagacgctgctggaggagaataccacgcagcagccgctgcatgagcttcaaatcgatccc
gcggtcctggaaaacgagctcattcaggtcgacacggactacgtgggctcgctcagtgcc
aagtccctggcacagtatattgaggccaaggtgcgggagcgacgtgatctgcgtcgcagt
aaactggtctccatccgactgattagtccacgacgggatgaggatcgtttgtacaatcag
ttggagtcccggaagtacaaggagaacaaggagaagatccggcgacgcaaggagctctac
cgacgacgcaaaatcgaggtcctaccggatgcggttgacgaaattcctgttcctggcaag
gcactacctattcagccctacttgttctcttccgacgaggaagaaactaaagtcgcagcg
atcgaacagcccgccgctgaggaggagcaggattcactgaacatggcaccgagcaccagt
catgccgccatggcggctctgggcaaggcagtggcccagccgactggattggggacggtt
ggcaaacgtaagctaccaatgccaccgagtgttacggtgaagaagcatcgccaggaacag
aggagcaagaaggtcaagagttcccagagtcccctgaccgcaaccagtgcacgcgaggcc
cacgagaagttccgctttgagataagcgggcatgtggccaatttcctgcgtccgtatcgc
aaggagagctgcacgctgggtcggatcaccagcgatgaggactacaagttcctggttaat
aggctaagctatcatattaccaccaaggagatgcggtattgcgaggtcagcgggaatccc
ctgtcctgcacggagtctgtgaagcacaagtcctacgacttcatcaatcagtacatgcgg
caaaaggggcccgtctacaagaagccggcggaaaacgattag

DBGET integrated database retrieval system