KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17800Help
Entry
Dmel_CG17800      CDS       T00030                                 

Gene name
Dscam1
Definition
(RefSeq) down syndrome cell adhesion molecule 1, isoform BH
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set fn3 Ig_2 Dscam_C ig V-set C2-set_2 Ig_5 Ig_4 Ig_6 Pur_ac_phosph_N C1-set
Motif
Other DBs
NCBI-GeneID: 35652
NCBI-ProteinID: NP_001036476
FlyBase: FBgn0033159
UniProt: Q0E9M4
LinkDB All DBs
Structure
PDB: 

Position
2R
AA seq 2035 aa AA seqDB search
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVPQSYTVNVMDESILRGNSAILKCHIPSFVADFIVVDSWVEDEE
RVIYPQEDIAESDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
ITEPIGSVAPRVNRKDEFNHDRIKSSKTISIQCPAQAFPVPVYRWYKFIEGTTRKQAVVL
NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF
GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA
SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ
VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA
IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
VAKNQEGYSARGSLEVQVMVPPHVLPFSFGSEVFNMGDVLSITCVVLKGDLPLRIHWTLN
GEPVATGVNGFTVMQLNQRTTYLSVDALEAKHRGSYSCVAQNQAGEAIYSADLQVNVPPR
WILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLH
VDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAK
GEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAF
GSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS
EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI
KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE
LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV
SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA
GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG
AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA
SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD
AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT
LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK
PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV
VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGSGHGNVHTRIRLPAW
MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA
TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLY
EELKAPPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQT
FPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPE
YDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYD
HYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHG
PRGNYGAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
NT seq 6108 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcccaacgaacgcctcaaatggctaatgctgttcgcagctgttgccctcatt
gcttgtggtagtcagaccctagctgccaatcccccagatgccgaccaaaaaggacccgtc
ttcctcaaggaacccaccaaccgcattgacttctccaactccacgggcgcagagatcgag
tgcaaggccagcggcaatcccatgcccgagattatttggatcaggagcgacggtaccgcc
gtgggtgatgtgcccggattgcgtcagatctcatccgacggcaagctggtcttccctcca
ttccgcgccgaggactaccgccaggaggtccatgcccaggtgtacgcctgcctggcccgc
aaccagttcggatccattatctcccgggacgtccatgtgcgagccgttgtgccacaatca
tacaccgtcaatgtcatggacgagtccatactgcgaggcaatagcgccatcctaaagtgc
cacattcccagttttgtggccgatttcatagtggtcgattcgtgggtggaggacgaggag
cgagttatctatccccaggaggatatcgcggaaagcgatggaaagtacctggtattgccc
tctggagagctgcacatccgtgaggttggacccgaggacggatacaagagctaccagtgc
cgaaccaaacatcgtctgaccggagaaacccgattaagtgccacaaaaggacgattggtc
atcacagaacccattggtagtgttgctccccgagtaaatcgcaaggatgagttcaatcac
gaccgtataaagagctcgaagacaatttccatacaatgtccagctcaggcctttccggtt
ccggtttatagatggtacaagttcatcgaaggaacaacccgtaaacaagctgtggtgcta
aatgaccgtgtgaagcaggtctctggtactctcattattaaggacgcagtagtcgaggac
tccggaaaatacctgtgcgtggtgaacaattccgtgggaggcgaaagcgttgagactgtg
cttaccgtcactgcccccctatccgctaagatcgatcctcccacacagacagttgacttc
ggacgccccgccgtattcacttgccagtacactggaaatcccatcaagaccgttagctgg
atgaaggacggcaaggctatcggacacagcgaacccgtgctgcgcatcgaatccgtgaag
aaggaggacaagggcatgtaccagtgcttcgtaagaaacgaccaggaatcggcggaggcg
agtgctgagctgaagctcggaggccgtttcgatccccccgtcatccgacaggccttccag
gaagagaccatggaacccggaccaagtgtattcctcaagtgcgtcgccggcggaaacccc
acgcccgaaatttcctgggaactcgacggcaagaaaatcgccaacaacgatcgctatcag
gtcggacagtatgtgacggtcaacggagatgtggtttcctatctgaacataacctcggtc
cacgccaacgatggcggtctctacaagtgcatagccaagagcaaagtgggcgtggccgaa
cactcggccaagttgaatgtatatggactgccctacatccggcaaatggagaagaaggca
attgttgctggagaaaccctgattgtcacatgtcctgtagctggataccccatcgattcg
attgtctgggagcgagataaccgtgccctgcccatcaaccgcaaacagaaggtcttcccc
aacggaacgctgattatcgagaatgtggaacggaactcagaccaagcgacctacacttgc
gttgccaagaatcaggaaggatactctgctcgaggatctctggaagtgcaagtcatggta
cctccccatgtcctgcccttcagtttcggcagcgaagtctttaatatgggcgatgttttg
agcatcacttgtgttgtcctcaagggggacctgcccttgagaatccactggaccttgaat
ggtgagcctgtggcaacaggtgtgaatggattcacagtaatgcagttgaatcaacgtacc
acctacctgagtgtggatgcactggaggccaagcatcgcggctcctatagctgcgtggct
cagaatcaggcgggtgaagcgatttactccgctgacctgcaagtcaatgtacctcccaga
tggatcctcgagcccaccgataaggccttcgcccagggatccgatgccaaggttgaatgc
aaggctgatggcttccccaaaccccaagttacatggaagaaagcagttggcgacaccccc
ggagagtacaaggatctaaagaagagcgacaacatccgcgtggaagagggcactctgcat
gtcgacaacatccaaaagaccaacgagggctactatctgtgcgaggctatcaatggaata
ggctccggcctctcggctgtgattatgatcagcgttcaggcccctccagagttcacggag
aagctgcgcaaccagaccgcccgacgaggagaacccgccgtactccagtgcgaggcgaag
ggcgagaagcccattggcatcttgtggaacatgaacaacatgcgactggacccaaagaac
gacaatcggtacaccattcgtgaggagatcctttccaccggagttatgtccagtctgtcg
atcaagcgcaccgagagatccgactccgccctattcacctgtgtcgccactaatgccttt
ggatccgatgacgccagcataaatatgattgtccaggaagttccggagatgccatatgct
ttgaaggtactcgacaaatccggacgttccgtgcagctgagctgggcgcaaccctacgat
ggcaactcccctctggacaggtacatcattgagtttaagcgttctcgtgcctcctggagc
gaaattgatcgcgtcatcgtgcccggacacaccacagaagcccaagtgcagaagctcagc
cccgccaccacctacaacattcgcatcgtggccgaaaacgccatcggcacatcccaatcc
tctgaagcggtcactatcatcacagccgaagaagcaccctccggcaagccccagaacatc
aaggtagaacccgtgaaccagaccaccatgcgcgtcacctggaagccaccaccacgcacc
gagtggaacggagagatcctgggctactacgtcggctacaagctatccaacactaactcg
tcctacgttttcgagaccatcaacttcatcaccgaggagggcaaggagcacaacctggaa
ctgcagaacctgcgcgtgtacacccagtactccgtggtgatccaggccttcaacaagatc
ggagctggtccactgagcgaagaggagaaacaattcacggccgagggaacgcccagccag
ccacccagtgacaccgcctgcaccaccttaacttcgcagaccattcgcgtcggatgggtg
agcccacccctggaatccgccaacggagtgatcaagacctataaggttgtctatgccccc
agtgacgagtggtatgacgagaccaagcgacactataagaagacggcctcctccgacaca
gtcctccatggcttaaagaagtacaccaactacacaatgcaggtcctggccacaacagcc
ggaggcgatggcgtccgcagcgttcccatccactgccaaaccgaacccgatgttcccgaa
gcacccactgatgtaaaggctcttgttatgggtaacgccgctatcctggtatcctggcgc
ccaccagcacagccaaacggcattatcacccagtacaccgtgtactccaaggccgaaggc
gctgagactgagacaaagacccagaaggttccccactaccagatgagtttcgaggccacc
gaactggagaagaacaagccctacgagttctgggtgacagctagcaccaccattggcgaa
ggccagcagtctaagagcatagtggccatgcccagcgaccaggtgcccgccaagatcgcc
tccttcgacgacaccttcactgccaccttcaaggaggacgccaagatgccctgcctggcc
gttggagccccccaacccgagatcacatggaagatcaagggcgtcgaattcagtgccaac
gatcgcatgcgcgtcctccccgacggatcgctgctgatcaagtcggtaaatcgccaggat
gccggagactactcctgccacgccgagaactcgattgctaaggactccatcacgcacaaa
ctgattgttctggcaccaccacaatcgccccacgtcaccctctcggcaaccaccactgat
gccctgactgtaaagttgaagccccatgagggagacactgctcctctgcatggatacacc
ctgcactacaagccagaattcggagaatgggaaacatcggaagtgtctgtcgactcacag
aagcacaacatcgaaggtctcttgtgcggctcccgctatcaggtctatgccacaggattc
aataacattggagctggcgaagcttctgacattttgaacacccggaccaagggacagaag
cccaagctgcccgagaaacctcgcttcattgaagtgtcgtccaactcggtgtccctgcac
ttcaaggcctggaaagatggaggatgccccatgtcgcactttgtggtggagagcaagaag
cgcgatcaaattgagtggaaccaaatttcgaacaacgtgaagcccgataacaactacgtg
gttttggacctggaacccgccacctggtacaacctccgcatcactgcccacaactcggct
ggcttcactgtggccgaatacgactttgccaccttaaccgttaccggaggcaccattgcg
cccctggacgacggatccggccacggcaacgtgcacacccgcatccgcctgcccgcctgg
atgcccgagtggctcgatctcaacttcatggtgcccctaattgccaccgtggtcgtggtg
gcggtgggcatctgcgtggtgtgcgtggccctatctcggaggcgagcggacgacatgcgc
ggcggccaaaaggatgtgtactacgatgtagtttacaatcagacaatgggacccggcgcc
accctggacaagcgtcgtccggacctgcgggatgagctcggatacatcgccccgcccaac
cggaagctgccccccgttcccggatccaactataatacctgtgaccggattaagcgaggc
cgcggtggcctccggtccaaccactcgacctgggaccctcgacgcaatcccaacctgtac
gaggagctgaaggccccgccagtgccgatgcacggcaaccattacggccacgcccacggc
aatgccgagtgccactacaggcatccaggcatggaagatgaaatctgcccctatgccacg
ttccacctgctcggattccgcgaggaaatggaccctaccaaggccatgaacttccagacc
ttcccccaccagaacggacacgccggcccagttcccggacacgcgggcactatgcttcca
ccaggacatccaggacacgtgcactcccgctccggatcgcaatcgatgcctcgggccaat
cgataccagcgaaagaacagccagggcggacagtcctcaatctacacgccagctcccgaa
tacgatgatcccgccaactgtgccgaagaggaccaatatcgtcgatacacccgcgtcaac
tcgcaaggcggtagcctgtactccggacccggacccgaatacgacgatcccgccaactgc
gcacccgaagaggatcagtacggctcccagtacggaggaccctatggacagccctatgat
cactacggttcccggggatccatgggacgtcgtagcatcggctctgctcgcaatcctggc
aatggatcacccgagcctccaccaccaccaccacgcaaccacgacatgagcaactcctca
ttcaacgactccaaggagagtaatgagatctcagaggcagagtgcgatcgtgaccacgga
ccacgcggaaactacggagcagtgaagcgatctccacaaccgaaagatcagcgcaccacc
gaagaaatgcgcaaactgatagaaagaaacgaaaccggcccaaaacaactccaactccaa
caagcaaatggcgcaggattcacagcctacgatactatggcagtgtaa

DBGET integrated database retrieval system