KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1906
Entry
Dmel_CG1906       CDS       T00030                                 

Gene name
alph
Definition
(RefSeq) alphabet, isoform F
  KO
K04461  protein phosphatase 1B [EC:3.1.3.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG1906 (alph)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG1906 (alph)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmel_CG1906 (alph)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    Dmel_CG1906 (alph)
SSDB
Motif
Pfam: PP2C PP2C_C
Other DBs
NCBI-GeneID: 43481
NCBI-ProteinID: NP_001247356
FlyBase: FBgn0086361
UniProt: A0A0B4K7Q3
LinkDB
Position
3R
AA seq 332 aa
MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFD
GHAGCKVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELPEFTRESEKCGG
TTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKR
VNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSN
EDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHR
LEKQIEKITRERELAEWANCQCKNKKQKAIQI
NT seq 999 nt   +upstreamnt  +downstreamnt
atgggcggattcctggataagccgaaaaccgccaagcacaatgacgagggtgagggcaac
aagctgctcttcggggtcagctcgatgcagggatggcggtcggagatggaggacgcctac
tacgctcgtgccgggctgggggatgccctgccggactggagcttctttgccgtgttcgac
gggcatgccggatgcaaggtgtcggagcactgtgccaagcaccttctggagagcattatt
agcaccgaggaattcattggaggcgaccacgtgaagggcattcgcaccggcttcctgcgc
atcgacgaggttatgcgggaactgccggaattcacccgggagtcggagaaatgcggcgga
actaccgccgtgtgcgcctttgtcggcctcacgcaagtgtacatcgccaattgtggtgat
tcgagggccgtcttgtgccgccagggtgttccggtgttcgccacgcaggatcacaaaccc
attctgccggaggagaaagagcgcatctataatgcgggtggcagtgttatgataaagcgc
gtaaatggtaccctggcagtgtcgagagcccttggggattacgactttaagaacgtcaag
gagaagggacagtgcgagcagttggtatcgccggaaccggagatattctgtcagagccgc
caggatagcgatgagttcctggtgctcgcttgcgatggaatctgggatgtgatgtccaac
gaggacgtgtgcagcttcatccactcgcgaatgcgggtgaccagtaacctagtgagcatc
gccaaccaggtcgtggacacctgcctgcacaagggtagccgcgacaacatgagcatcatc
atcattgccttccccggagctccgaagcccaccgaggaggcgatagaggctgaacatcgt
ctggaaaagcaaatcgagaagatcacaagagagcgcgaattagccgaatgggccaattgt
caatgcaagaacaagaaacagaaagcaattcaaatttaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6036
Entry
Dmel_CG6036       CDS       T00030                                 

Gene name
CG6036
Definition
(RefSeq) uncharacterized protein
  KO
K04461  protein phosphatase 1B [EC:3.1.3.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG6036 (CG6036)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG6036 (CG6036)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmel_CG6036 (CG6036)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    Dmel_CG6036 (CG6036)
SSDB
Motif
Pfam: PP2C PP2C_C PP2C_2
Other DBs
NCBI-GeneID: 43185
NCBI-ProteinID: NP_651472
FlyBase: FBgn0039421
UniProt: Q9VBF9
LinkDB
Position
3R
AA seq 371 aa
MGHKMGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYF
AVFDGHAGSQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDMRKLYHDQQGGS
TAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRI
NGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSS
EVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLLLLPGAPKVDMDAVKAERSL
DQTIVQITKEVIEKHEIHDFETLIRLMKRMAINIPNLPPGGGLYAKYYIIEQAFHEKFPD
TPAEIYDYFSM
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggtcataaaatgggtggcttcttggaaaaaccagaaactgaaaagcaggctcaagag
ggtcatgggaatgggctgcgatactgcgtaagttctatgcaaggttggcgattggaaatg
gaggatagccactcggctgcttgccggctgaaggatcccttcgcaacgtggtcatatttt
gcggtgttcgatggtcacgctggcagtcaaatatcactgcattgcgctgaacatctaatg
agtactatattggaatccgaatctttttcgaagcacaaatacgaggctggcatacgagag
ggcttcctgcagttggatgaggatatgaggaagctgtatcacgaccagcaaggcggctcg
acggccatttgtgtttttgtatcaccggacaaaatatatctggtcaattgtggtgactcg
cgtgcagtgatatcgcgaaatggagcagctgtcatcagtacaattgatcacaagccgttt
tctcccaaagaacaagaacgcattcaaaatgccggaggcagtgtaatgattaaaaggata
aatggcactctggcagtttcccgggccttcggtgactatgatttcaagaatgatggctca
aagtctcctgtcgatcagatggtgtctccggaacctgatataatagtttgcaatcggtcc
gaacacgatgaattcatagttgtagcctgcgatggcatttgggatgtgatgactagcagc
gaggtttgtgaatttattaggtcacggcttttggtgacctatgacctgccgatgattgtt
aacagcgtattggatatttgcctgcataaaggcagcagggacaatatgacactgctcctc
ctacttttgcctggagcaccaaaggtcgatatggatgcagttaaggccgaaaggagtctt
gatcaaactattgtgcaaataaccaaggaagtgattgagaagcacgaaatacacgacttt
gaaacacttatacgactgatgaaaagaatggccattaacattccaaatctaccacctggc
ggtggtctttatgcaaaatattacattatagagcaagctttccacgagaaatttccagat
actccggctgaaatatatgattatttttccatgtag

DBGET integrated database retrieval system