KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2107Help
Entry
Dmel_CG2107       CDS       T00030                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00071  Fatty acid degradation
dme01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dmel_CG2107 (CPT2)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     Dmel_CG2107 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 38355
NCBI-ProteinID: NP_647756
FlyBase: FBgn0035383
UniProt: Q9VZW7
LinkDB All DBs
Position
3L
AA seq 667 aa AA seqDB search
MFRTRVHRNLSWISTNSSRTTTTHGQHYQYLQCSKLPTLYFQRSLPRLPIPLLENSCRRF
LEATKPLLSPAEQAQTQQTVEQFRQGIGMELHAKLKSHDAENKHTSYISQPWFDMYLADR
APLPLNYNPLLVMKSDARPEYQQQVVRATNLIISSLRFWRSLQADLLEPEVYHMNAKKSD
TSSYRRWMKVAPKAFATYASYAFKAFPLDMSQYNRLFGTSRIPRIGKDELVQSPDAKHIL
VMRRGHMYAVNVLDSSGYIESPSVILGRLRAVLKLDADREAASVPLGVLTSGQRDEWAKT
RQHFVSNTKNADLLEREVDAALFCVCLDGEEDGVFNENQQEPLLKHLLAGKAQNRWFDKS
ISLLISADGTTAINFEHSWGDGVAVLRYFNELYKDTLKQPFVSTETVHTPAEGDFSNVRP
INFEIDDATKSAVSEAYNKNASIVDNLDMNVLKYPHINKPTCKQYGLSPDSIIQLSFQLA
YRQAYSGYVGSYESCSTSAFRHGRTETMRPCTNATRDFCEAILQPERSKPSAGELRAMID
NCSKVHGQLTKEAAMGQGFDRHLFALRHTAQKEGIPIPDLYETEAYKRINNNIISTSTLG
SDALLAGSFGPVVKNGFGIGYSIQNDFAGAIVTTYKNQADGKVFIDSLESAFDKICAVIQ
QSSSSKK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggacccgggtgcaccgcaatctgtcgtggatatcgacgaactcgtcgaggaca
acgaccactcatggccagcactaccaatacctgcaatgttccaagctgccaacgctgtac
tttcagcgctccttgccgcgattgcccattcctctgttggagaacagctgtcggcgtttc
ctggaggccaccaagccactactctcgccggcggagcaggcgcagacccagcaaacggtg
gaacagtttcgccaggggatcggcatggaactacacgcgaaactcaagagccatgatgca
gagaacaagcataccagctacatctcgcagccctggttcgacatgtatctagccgatcga
gcgcccctgccactcaactataatccgctgctggtgatgaaaagcgacgcgcgaccggag
taccagcaacaggtggttagggctaccaacctgatcatcagctcgttacggttctggcga
tctctgcaggcggatctcctggagccggaggtgtaccacatgaacgccaagaagagcgac
acttccagctaccgcaggtggatgaaggtggctcccaaagcctttgccacctacgcgtct
tatgccttcaaggcctttccgctggacatgagccagtacaaccggttgtttggcacctct
aggattcctaggatcggcaaggacgagctggtccagtcaccggacgccaagcacattctg
gttatgcgccgcggtcacatgtacgccgtaaatgtgctggactccagtggatacatcgag
agtcccagtgtgattctgggcagactaagggctgtgcttaagcttgatgcagatcgcgag
gcagccagcgtgccacttggtgttctgacctccggacagcgtgatgagtgggccaagaca
agacagcattttgttagcaacaccaaaaatgccgatcttctggagagagaggtggatgcg
gctctgttctgcgtttgtctggatggcgaagaagatggagtctttaacgaaaaccagcag
gagccgctgctcaagcatttgctggcgggaaaagcgcagaatcgttggttcgacaaatcc
atttccctgcttataagtgcagatggaacaacggctattaacttcgagcactcgtggggc
gatggagtggctgtgcttcgctactttaacgagctctacaaggatactttgaagcagccg
tttgtatccacggagacagtgcacactcccgccgaaggcgattttagcaacgtgcggccc
atcaacttcgaaatcgacgatgccaccaagtcggccgtttcggaggcttataataaaaac
gccagcattgtagataatctggacatgaatgtgctgaagtacccacacatcaacaagccc
acatgcaagcagtatggcctaagtccggactccatcattcagctgtccttccagctggct
tatcgccaagcctacagcggctatgtgggcagctacgaatcctgcagcacatccgccttc
cgacacggacgtaccgaaacgatgcgaccgtgcacaaatgccacacgggacttctgtgaa
gctatcctccagccggagaggagcaagcccagcgccggagaactacgagcaatgatcgac
aattgcagcaaggtgcatggccagttaaccaaggaggcggctatgggccagggcttcgat
cggcatctctttgcccttcggcacacggcccaaaaggagggaataccaattcccgatctc
tatgagactgaggcttacaagcgcattaataacaacatcattagtacctcaacactgggt
tcagatgccctgctagcgggttcctttggtccggtggtcaagaatggcttcggaatcggc
tattcgattcagaacgattttgccggcgccattgtcaccacgtacaaaaaccaggccgat
gggaaggtgttcatagacagtctggaatcggcatttgataaaatttgcgctgtcatccag
cagagcagcagtagcaagaagtag

DBGET integrated database retrieval system