KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2272
Entry
Dmel_CG2272       CDS       T00030                                 

Gene name
slpr
Definition
(RefSeq) slipper, isoform C
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG2272 (slpr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG2272 (slpr)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     Dmel_CG2272 (slpr)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: TKL group
  MLK family
   Dmel_CG2272 (slpr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH3_1 SH3_9 SH3_2 Pkinase_fungal
Other DBs
NCBI-GeneID: 44111
NCBI-ProteinID: NP_001188559
FlyBase: FBgn0030018
UniProt: Q95UN8 M9MS26
LinkDB
Position
X
AA seq 1148 aa
MLPISEEQQLQQQQQQQQLEQLHHPQIPEIPIPDLEQVETQVGDGSLWTALYDYDAQGED
ELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFVTDEDPLQLNVSSAIGDIQ
PHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLF
WALKHENIAALRGVCLNTKLCLVMEYARGGSLNRILAGKIPPDVLVNWAIQIARGMNYLH
NEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMP
PEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPET
WGALMKSCWQTDPHKRPGFKEILKQLESIACSKFTLTPQESFHYMQECWRKEIAGVLHDL
REKEKELRNKEEQLLRVQNEQREKANLLKIREQNLRERERVLIERELVMLQPVPSKRKHK
KGKKNKPLQISLPTGFRHTITAVRDKAEQPGSPSFSGLRIVALTDGHKGKTWGPSTMHQR
ERSLLPSQLSGGQPEWPAQTSTHSSFSKSAPNLDKKQQQQNQQQVASLTPPPGLGILGGS
GGAGGTPATPLLYPGIPIILTRPNNNNIGNCKAITTTITTTTTTTTNNNNNNNNSISANN
NNQLNNISTINSNNNNNQTNLTSQPNTIIVLQNGRNNSNSSTTSQSPAKIYHRARSQEYG
LDHPLAYQPPPLYLVTDDSSETDTVASPTGCFHFLKSGNSSAASGAVHLHRFGGSLGNSP
AVGRKKHSLDSSSHHPPANGSNSFALPNQLTLPSEDNNTYDHAFYRDVIKKMSMASSERV
NSKSSGDLTMYNSSTPLTARDCDDAEEAFEGGRFQRNFSGSQFPRHCFFTRQEEEGEAED
EDAVAAEVDTADADADDECQVPASQMRQNSTTSRKSSVTFQSVSFEEPDFVATPRTTARS
DLYTSSASISFATYRSASPSLSSSSTTASASPSIASTEAVNGYHMQENSILNTRRMQDVQ
PHPDVIKLRAQEQRQQTKNQKKQRPKHITKSKSVEAPVEGQHHEHDDHNDPQHQHHSAGS
SKIRALFNLFTRSRKKYSKLAEHNMVGGPEFCAIDPYQTDLAMGGSSRSLKRKGKKPQTQ
SCEQLERC
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgctgccgatcagcgaggagcagcagctgcaacagcagcagcagcagcagcagttagag
caactgcatcatccgcagataccagagattcccataccagatctagagcaagtcgagacc
caggtgggcgatggcagcctgtggaccgcgctgtatgactacgatgcccagggcgaggat
gagctgacactgcgacgcggcgaaatcgttgtggtcctgtccacggacagcgaggtgtct
ggcgatgtgggctggtggaccggcaagattggagataaggtcggtgtctttcccaaggac
tttgtcaccgatgaggacccactgcaactgaatgtctcgtccgccattggcgacatccag
ccgcatgagatcgaatacaatgagctggacatcaaggaagttatcggctccggtggcttc
tgcaaggtccatcgtggctactacgatggcgaggaggtggctattaagattgcccatcaa
acgggcgaggatgatatgcagaggatgcgggacaatgtcctgcaggaggccaaactgttt
tgggccctcaagcacgaaaatatagcagccctgcgaggagtatgtctgaataccaaactc
tgtctggtgatggagtatgccaggggaggaagtctcaatcgcatactggctggcaagata
ccacccgatgtactagtcaactgggccattcagatagccagaggcatgaactatctgcac
aatgaggcgcccatgtcgatcatacatcgcgacctcaagtcctccaatgtgctgatctac
gaggccatcgagggcaatcatctgcagcagaagacgctcaagatcacggatttcggtttg
gccagggagatgtacaacacgcagaggatgagtgcggcgggcacgtacgcttggatgcca
ccggaggtcatcagcgttagcacctattccaaattctccgatgtttggagctacggtgtc
ttgctgtgggaactgataacgggcgagacgccctacaagggcttcgatccgttgtccgtg
gcctatggcgtggctgttaacacgctgacattgcccataccaaaaacctgccccgagacg
tggggagccctgatgaagagctgctggcaaacggatccgcacaagcgaccgggcttcaag
gagattctcaaacagctggagagcatcgcatgctccaaattcaccctaacgccccaggag
tcgtttcactacatgcaggaatgctggcgaaaggagatcgctggagtgctacacgatttg
cgcgaaaaagaaaaggaactgcgcaacaaggaagagcagctgctcagggtgcaaaacgag
cagcgcgaaaaggcgaatctcctgaagatccgggagcagaatctgcgcgagcgtgaaaga
gtgttgatcgaacgggagcttgtcatgttgcagccggtgccatcgaaacgcaaacacaaa
aagggcaaaaagaacaaaccactgcagatatcgctgcccacgggcttccggcacacgatt
acggctgtacgcgacaaggcggaacagccgggatcaccttccttctccggattgcgcatc
gtggcactgaccgatgggcacaagggcaagacgtggggcccgtcgacgatgcaccagcgg
gagcgatccctattgccttcgcaactgagcggcggtcagccggaatggcccgcccagacc
tcaactcactcctcattcagcaagagtgctccgaatctggacaagaagcagcagcagcag
aaccagcaacaggtggcctcgctgacaccgccgccgggtttgggaattttgggtggaagt
ggaggcgctggtgggacgccggccacaccattgttgtacccaggtatacccattatacta
acgcgccccaacaacaacaacattggcaattgtaaagccatcaccaccaccatcacaact
accaccaccacaaccaccaacaacaacaacaacaacaacaacagcatctccgccaacaac
aacaatcagctaaataatattagtactattaatagcaataacaataacaatcaaactaac
ctgacctcccaaccgaacacgataattgtcctccaaaacggccggaacaactccaacagc
agcaccaccagtcaatccccagccaagatctaccatcgcgccaggagccaggagtacgga
cttgatcatccgcttgcttatcagccaccaccactctatttggtaacggatgacagctcg
gaaacggacaccgttgccagtccgaccggttgctttcacttcctgaagtccggcaattca
tcggcggccagtggtgccgtgcatctgcatcgctttggcggcagtctgggcaacagtcca
gctgtgggcagaaagaagcattcgctggacagcagcagtcatcatccgcctgcgaacggt
agcaatagctttgcactgcccaaccagttaactctgccatcggaggataacaatacgtat
gaccatgccttctatcgggatgtgatcaaaaagatgtccatggccagcagcgaaagggta
aactccaaatccagtggcgacctgaccatgtacaactccagcacaccgctgactgccagg
gattgcgatgatgcggaggaggccttcgagggtggacgctttcagcgtaacttttccggc
tcgcagtttccacggcactgcttcttcaccaggcaggaggaggaaggggaagcagaggat
gaggacgcggtggcggcggaggtggacacagcagatgcggatgccgacgatgagtgtcaa
gtgcccgccagtcagatgcgccagaactccaccacgtcgcgcaagagttcagtgaccttc
cagagcgtcagtttcgaagagcccgattttgtggccacgccgcgaacgactgccagatcg
gatctatatacatccagtgcctcaattagcttcgccacctaccgctccgcctcgccatcg
ctgtcctcatcgtccaccactgcgtccgcctcaccgtccattgcttctacggaagccgtg
aacggctatcacatgcaggagaactccatactgaatacgcgtcggatgcaagatgttcag
ccgcatcccgatgtcattaagctgcgggcccaggaacagcgccagcagaccaagaaccaa
aagaagcaacggcccaagcacataaccaaatccaagtctgttgaggcgccagtcgaggga
cagcaccatgaacatgatgaccacaatgatccccagcaccagcatcactcggctggatcg
agcaaaatccgtgcccttttcaatctctttacgcgctcgcgaaagaagtacagcaagctg
gcggagcacaacatggtcggtggacccgagttctgtgccattgatccctatcaaaccgat
ttggcgatggggggcagcagtcgctctttgaagcgcaaaggcaaaaagccgcagacgcaa
tcctgcgagcaactggagcgatgctaa

DBGET integrated database retrieval system