KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2275
Entry
Dmel_CG2275       CDS       T00030                                 

Gene name
Jra
Definition
(RefSeq) Jun-related antigen, isoform A
  KO
K04448  transcription factor AP-1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04137  Mitophagy - animal
dme04214  Apoptosis - fly
dme04310  Wnt signaling pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG2275 (Jra)
   04310 Wnt signaling pathway
    Dmel_CG2275 (Jra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG2275 (Jra)
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG2275 (Jra)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG2275 (Jra)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG2275 (Jra)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    Dmel_CG2275 (Jra)
SSDB
Motif
Pfam: bZIP_1 Jun bZIP_2 bZIP_Maf DUF3450 Phlebovirus_NSM
Other DBs
NCBI-GeneID: 36057
NCBI-ProteinID: NP_476586
FlyBase: FBgn0001291
UniProt: P18289
LinkDB
Position
2R
AA seq 289 aa
MKTPVSAAANLSIQNAGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNTSTPNPNKRPG
SLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKAGP
VTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMTAVNNGISGGTFTYT
NMTEGFSVIKDEPVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKL
EDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQ
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaaaacccccgtttccgctgctgcgaacttaagtattcagaatgctggcagttccgga
gcaactgccattcagatcatacctaaaaccgagcccgttggagaagaaggccccatgtca
ctggactttcagtcgccgaacctgaacacatccaccccgaatcctaacaagcgtcccggc
tcgctggatctgaacagcaagagtgccaagaacaagcgcatcttcgcaccactggtcatc
aactcaccggatctgtcatccaagacggtaaacacacccgatttggagaagatcctgcta
tccaacaatctgatgcaaacaccgcagccgggaaaggtgttccccaccaaggcggggccc
gtcaccgtggagcagttggacttcggcaggggattcgaggaggccttacacaatcttcac
actaactcccaggcatttccgtccgccaattccgccgctaattccgccgccaataacaca
actgcggcagccatgacagcggtgaacaatggcatcagcggaggcaccttcacctacacc
aacatgaccgagggcttctcggtgattaaggacgagcccgtcaatcaagccagctcgccc
accgttaatcccattgacatggaagcgcaggagaagatcaagctggagcgcaagaggcag
cgtaaccgtgtggctgcatccaagtgccgcaagcgcaagttggagcgcatctcaaagctg
gaggatcgcgtgaaggtacttaagggcgagaacgtcgacctggctagcatcgtgaagaac
ctcaaggaccatgtggcgcagctgaagcagcaggtgatggagcacattgccgcgggctgc
acggtgccgccgaactcgacagaccaataa

DBGET integrated database retrieval system