KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2512Help
Entry
Dmel_CG2512       CDS       T00030                                 

Gene name
alphaTub84D
Definition
(RefSeq) alpha-Tubulin at 84D
  KO
K07374  tubulin alpha
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG2512 (alphaTub84D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG2512 (alphaTub84D)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG2512 (alphaTub84D)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG2512 (alphaTub84D)
   04147 Exosome [BR:dme04147]
    Dmel_CG2512 (alphaTub84D)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     Dmel_CG2512 (alphaTub84D)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     Dmel_CG2512 (alphaTub84D)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    Dmel_CG2512 (alphaTub84D)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG2512 (alphaTub84D)
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG2512 (alphaTub84D)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG2512 (alphaTub84D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 40904
NCBI-ProteinID: NP_524264
FlyBase: FBgn0003885
UniProt: P06605
LinkDB All DBs
Position
3R
AA seq 450 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGMDSGDGEGEGAEEY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatgtatctctatccacgtgggccaggccggagtccagattggaaatgcctgc
tgggagctctattgcctggagcacggcatccagcccgatggccagatgccctccgacaag
accgtaggcggaggtgatgactcgtttaacaccttcttcagcgagactggagctggcaag
cacgtgcctcgcgccgtgttcgtggatctggagcccactgtggtcgacgaggtccgtact
ggaacctaccgtcagctgttccaccccgagcaactgatcaccggtaaggaggatgcggcc
aacaactacgcccgtggccactacaccattggcaaggagatcgtcgacctggtgctggac
aggatccgcaagctggccgatcaatgcaccggtctgcagggcttcctcatcttccactcg
ttcggtggaggtaccggctccggcttcacctcgctgctgatggagcgtctctccgtggac
tacggcaagaagtccaagctggagttcgccgtgtacccagctccgcaggtgtccaccgcc
gtggtggagccctacaactccatcctaaccacgcacaccaccctcgagcactccgactgc
gcctttatggtggacaacgaggccatctacgacatctgtcgccgaaacctggacatcgaa
cgacccacttacactaacctgaatcgtttaatcggccaaatagtgtcctcgatcaccgcc
tctctgcgattcgatggagccctaaatgtggacctcaccgagttccagaccaacctggtt
ccttacccccgcatccacttcccgctggtgacgtacgctcccgtcatctccgccgagaag
gcctaccacgagcagctgtcggtggccgagatcaccaacgcctgcttcgagccagccaac
cagatggtcaaggtggatccccgtcacggcaagtacatggcctgctgcatgctgtatcgc
ggcgatgtggtgcccaaggacgtgaacgccgccatcgccaccatcaagacaaagcgtacc
attcagttcgtggactggtgccccaccggcttcaaggtgggcatcaactaccagccaccc
actgtcgtcccaggcggggatctggccaaggtgcagcgtgccgtgtgcatgttgtccaat
accacggctattgccgaggcctgggcccgtctggaccacaagttcgatctgatgtacgcc
aagagggccttcgtccactggtatgttggtgagggcatggaggagggcgagttctccgag
gcccgtgaggatctggctgccctcgagaaggactacgaggaggtcggcatggattccggt
gacggtgagggcgagggtgctgaggagtactag

DBGET integrated database retrieval system