KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2862
Entry
Dmel_CG2862       CDS       T00030                                 

Symbol
HINT1
Name
(RefSeq) histidine triad nucleotide binding protein 1, isoform C
  KO
K02503  histidine triad (HIT) family protein
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG2862 (HINT1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG2862 (HINT1)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 33471
NCBI-ProteinID: NP_001259964
FlyBase: FBgn0031459
UniProt: Q8STA5
LinkDB
Position
2L:2770135..2770904
AA seq 150 aa
MFLSTGRNFFRVFSSRQIASCSARMASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDD
KCVAFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRV
VINNGKHGAQSVYHLHLHFLGGRQMQWPPG
NT seq 453 nt   +upstreamnt  +downstreamnt
atgttcttgtcaaccggccggaatttctttcgtgttttcagctctcgccaaatagcaagc
tgcagtgctagaatggcaagcgaagtggaaaaatcgcaaacggcagccgccagtgaagac
accattttcggcaagattttgcgcaaggagatcccatgcaaatttatccacgaggatgat
aaatgcgttgccttccacgatgtggcgccccaggcaccaacccacttcctcgtgattcct
cgcaagccaattgcccaactctcgctagccgaggatggagatgccgatctgctgggacat
ctcatgctggtgggccgcaaggtggccaaggagctcggcctcgcggatggctaccgcgtg
gtcatcaacaatggcaagcacggcgcccagtcagtttaccacttgcatttgcacttcctc
ggcggccgccagatgcagtggccaccaggataa

DBGET integrated database retrieval system