KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31289
Entry
Dmel_CG31289      CDS       T00030                                 

Gene name
Dph5
Definition
(RefSeq) diphthamide methyltransferase
  KO
K00586  diphthine methyl ester synthase [EC:2.1.1.314]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dme03012]
    Dmel_CG31289 (Dph5)
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.314  diphthine methyl ester synthase
     Dmel_CG31289 (Dph5)
Translation factors [BR:dme03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    Dmel_CG31289 (Dph5)
SSDB
Motif
Pfam: TP_methylase
Other DBs
NCBI-GeneID: 42663
NCBI-ProteinID: NP_524452
FlyBase: FBgn0024558
UniProt: Q8IN02
LinkDB
Position
3R
AA seq 281 aa
MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSILGCSLEDMQEFYGRPLLLADRDL
VEQGADEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCC
GLQLYKFGETVSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRK
EYMPPRFMTVAEAAHQLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEM
RSTDLGGPLHSLIIPAKEMHPLEVEFLQQYAPSIKLDDYNH
NT seq 846 nt   +upstreamnt  +downstreamnt
atgttctacctaatcggcctcggccttggcgacctgaaggacatcacggtcaagggtctg
gagatagtgaagcaatgcagtcgcgtctatctggagatgtacacctcgattctgggctgc
agccttgaggatatgcaagagttctatggacgaccactgctgctagccgaccgcgatctg
gtggagcagggtgcggatgagatcctggcgggtgcgggcgaatccgatgttgcgctgctc
gtggtgggcgacccctttggcgccaccacccacacagacttcatactgcgcgccaaggag
aagaacatcccctacaaggtcatccacaatgcatcgatcatgaacgccgtcggctgctgc
ggcctgcaattgtacaaattcggcgagaccgtttcgattccgtactgggacgagacatgg
aagccggacagcttctacgacaagatcaagctgaatcgcctgcacaacatgcacacgctg
tgcctgctggacatcaaggtgaaggagcccacgccggagtccttgatgcgcaaacgcaag
gagtacatgccaccgcgtttcatgaccgtggcggaggcggctcatcagttgctgtccatt
gtggagaagaaggactcgctggagaagaacacagtgctcaacgagcagtcactgtgcgtt
ggactggcccgtgttggccaggagtcgcagcagattgccgttggcacgctgcttgagatg
cgctcgaccgatttgggcggaccgctgcactcgctcatcattcccgccaaggagatgcat
ccgctggaggtggagttcttgcagcagtatgcccccagcatcaagctggacgactacaac
cactaa

DBGET integrated database retrieval system