KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31365Help
Entry
Dmel_CG31365      CDS       T00030                                 

Gene name
CG31365
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-AD zf-C2H2_4 zf-C2H2_11 zf-H2C2_5 zf-C2H2_3rep zf-C2H2_8 zf-C2H2_jaz Porin_5 zf-Di19
Motif
Other DBs
NCBI-GeneID: 42736
NCBI-ProteinID: NP_732827
FlyBase: FBgn0051365
UniProt: Q8T051
LinkDB All DBs
Position
3R
AA seq 639 aa AA seqDB search
MDAQPSYPDLATLCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRIC
QECRYQLEKSFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAF
IEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRK
ELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQV
KEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLE
LDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYN
IKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKR
KRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKG
GTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQ
CPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQ
CGRQFNDRSAVQRHVTTMHKVKNKLTDYISETNEFQAVA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacagccgtcgtatcccgatttggcgaccctgtgccgcctttgcctcaaggag
caccaggatgcgtacgcgatcttcgacgaggacgacacccagctctcgatacccgtgcgc
ctgatggcctgcgtcgcactggacgccaaggcgacggatactctgccgaagaggatctgc
caggagtgccgctatcagctggagaagtcattcctgttccggcagcgctgccaatgggcg
gagaagaagcttcgcaagcatatccgacttctgggtctcgggaagcgaagccgcgtcttc
tccaaggatccggacgattatgacgaggacgagctggagttcgaggactctattgccttc
atcgaggtgcaggacaaagtgcgcaagcttgaggacgaaaagtggcgagaagattttaag
gaagaacaggcggcggaaatgcacaaacggctggtcaaatctcgtctagaacttcgagcg
aaactgaccaccgaactgcgcaaggaactagcggaggaggtgcgcagtgaggttcgcaag
gagctggccgaggaggtgcgcagccaggttagagatgacctgcgaaacgaggtgagcgag
gacataagaaaagagcagctggccatgctgttgggcgaattggaggtgtatcttaccgag
aaaaaggccggtcggtgggagtctttggatgggtccgaaccagagaccaagccgcaagtc
aaggaagatgcctccccttctaggtcaaaaactaaagctcttccaaagcgacgacccagc
ttggtcgacgccaatctaaaggcgacagaggccaggaaggatgcaaaagaagaggaattc
atattgggctgcaataccgaccccgcaaataatagcgatgtaaacatagatggcctcgaa
ctggacgaggaagtgcccgcggaaagcggtgaagacttcagggaaatcaacatggttgga
tcagatgtagtgcacacagacaatggagagatttacatcataaactctgccagctcagag
gatcaaaaccaggactccactcccgaatttgaccaggacaacggaatcacctcctataac
atcaaagaagacggcgaaattcagttcagtggcgaaaagccagaggaaatcgaagacgtg
gtcgtgtttaatctgggcgaggagatatctcaggagcaacaggtcttcagcttccatgaa
aatgtcattatagtggaaaaagaacagaacgatagagatgagcagacgcccctcaaacga
aagagatcgagtgagttggtgttcaagcaggagtccagttgtcctcaaccaaaaaccggt
cgaattacggacacggtgaagtcgttccagtgccatttgtgcccggtggcatttcctacg
cagaaacttctgacgcgccaccacaacacccacattaagggactgaaaagtggaaagggc
ggcacgctcaagtgtcccagctgcgcactgcaactgtcgtgcgccagctcgctcaaacgc
cacatgattatccacacgggcctgaaacccttcaagtgcagcgagtgcgaactgtccttc
tcccagcgcgaagtgctcaagcgtcacatggacacccatacgggagtaaagcgccatcag
tgcccccaatgctcgagctgctttgcccagaagtccaacctgcagcagcacattggccgc
gtgcatatgggcaactctcggacgcacaagtgtcatctgtgtcatcgtagcttcaatcat
gtttcgggcctcagtcgccatctggtcacccacgctggcgtcatgttctcctgcaaacag
tgcggccgtcagtttaacgatcgcagtgcggtccagagacatgtaaccacaatgcacaag
gtgaagaacaagctcacagactacatatccgagacgaacgagtttcaagctgtggcctag

DBGET integrated database retrieval system